Property Summary

NCBI Gene PubMed Count 26
PubMed Score 32.38
PubTator Score 19.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (9)

PMID Text
25755721 these findings demonstrate that HMBG3 may be a potential molecular marker for predicting the prognosis of esophageal squamous cell carcinoma patients
25647262 our data suggests HMGB3 may serve as an important oncoprotein and indicate that overexpression of HMGB3 in urinary bladder cancer could be used as a potential prognostic marker.
25095979 High expression of HMGB3 is associated with lymph node metastases in gastric cancer.
24993872 In this family, microphthalmia, microcephaly, intellectual disability, and short stature are associated with a mutation on the X chromosome in the HMGB3 gene.
24338397 Association between co-expression networks involving HMGB3 and differentially-expressed genes in gastric cancer.
24098490 regulation of HMGB3 by miR-205 reduced both proliferation and invasion of breast cancer cells.
23609034 HMGB3 plays an important role in non-small cell lung cancer progression.
23326140 HMGB3 has a role in gastric cancer disease onset and progression by regulating the cell cycle
22912879 Data indicate that myomiR-206 modulates Hmgb3 expression during myogenesis.

AA Sequence

MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVR      1 - 70
YDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDSEKQ     71 - 140
PYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEEEEEEEEEEEEEEDE              141 - 200
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755721 2015 Increased expression of HMGB3: a novel independent prognostic marker of worse outcome in patients with esophageal squamous cell carcinoma.
25647262 2015 Overexpression of HMGB3 protein promotes cell proliferation, migration and is associated with poor prognosis in urinary bladder cancer patients.
25416956 2014 A proteome-scale map of the human interactome network.
25095979 2014 Upregulation of miR-513b inhibits cell proliferation, migration, and promotes apoptosis by targeting high mobility group-box 3 protein in gastric cancer.
24993872 2014 Identification of an HMGB3 frameshift mutation in a family with an X-linked colobomatous microphthalmia syndrome using whole-genome and X-exome sequencing.
24531895 2014 A systematic nomenclature for the redox states of high mobility group box (HMGB) proteins.
24338397 2013 HMGB3 characterization in gastric cancer.
24098490 2013 Tumor suppressive function of mir-205 in breast cancer is linked to HMGB3 regulation.
23609034 2013 Prognostic value of HMGB3 expression in patients with non-small cell lung cancer.
23326140 2012 High mobility group-box 3 overexpression is associated with poor prognosis of resected gastric adenocarcinoma.
22912879 2012 Hmgb3 is regulated by microRNA-206 during muscle regeneration.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22241470 2012 Regulation of transcription factor Twist expression by the DNA architectural protein high mobility group A2 during epithelial-to-mesenchymal transition.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20598277 2010 Terminal osseous dysplasia is caused by a single recurrent mutation in the FLNA gene.
19956199 2010 NUP98-HMGB3: a novel oncogenic fusion.
19890330 2009 HMGB proteins function as universal sentinels for nucleic-acid-mediated innate immune responses.
16945912 2006 Hmgb3 regulates the balance between hematopoietic stem cell self-renewal and differentiation.
16381901 2006 The LIFEdb database in 2006.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358624 2005 Hmgb3 deficiency deregulates proliferation and differentiation of common lymphoid and myeloid progenitors.
12714519 2003 Hmgb3: an HMG-box family member expressed in primitive hematopoietic cells that inhibits myeloid and B-cell differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9598312 1998 Hmg4, a new member of the Hmg1/2 gene family.
9370291 1997 Isolation of human and mouse HMG2a cDNAs: evidence for an HMG2a-specific 3' untranslated region.