Property Summary

NCBI Gene PubMed Count 59
PubMed Score 33.56
PubTator Score 166.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (24)

PMID Text
25937287 Lrp1-antisense directly binds to high-mobility group box 2 (Hmgb2) and inhibits the activity of Hmgb2 to enhance Srebp1a-dependent transcription of Lrp1.
25327479 siRNA-mediated silencing of HMGB2 increased the sensitivity of the head and neck squamous cell carcinoma cell lines to cisplatin and 5-fluorouracil.
25284587 Data show that odulation of RNA helicase DDX18 directly affects growth of tamoxifen-resistant cells, suggesting that it may be a critical downstream effector of the estrogen receptors (ERs) and high mobility group box 2 (HMGB2) complex.
25060178 the combination of a HMGB1+ and HMGB2- expression potentially predicts a poor prognosis in patients with pancreatic ductal adenocarcinoma
24684392 This study found that single nucleotide polymorphisms of HMGB1 may serve as potential biomarkers for predicting the efficacy of platinum-based chemotherapy.
23828241 The present data suggest that HMGB2 expression is a significant prognostic factor for glioblastoma and might play an important role in cell invasion.
23255232 HMGB2 is necessary to protect colorectal cancer cells from DNA damage and efficient DNA repair and p53-mediated downregulation is a critical mechanism of modulating HMGB2 expression.
23143110 Transient local HMGB2-DNA contacts dominate the DNA-bending mechanism used by HMGB proteins to increase DNA flexibility.
22644337 Crohn's disease in the colon and ulcerative colitis can be differentially diagnosed using anti-HMGB/HMGB2 antibodies combined with anti-Saccharomyces cerevisiae antibodies.
21890638 The age-related loss of HMGB2 in articular cartilage may represent a mechanism responsible for the decline in adult cartilage stem cell populations.
20851854 The results can partly be explained by altered cell proliferations by HMGB2 associated with the antiapoptotic pathway.
20036050 Our findings collectively suggest that HMGB2 could stabilize p53 by interfering with E6/E6AP-mediated p53 degradation in HPV-positive HeLa cells.
19965638 HMGB2 potentiates GATA-1-dependent transcription of GFI1B by Oct-1 and thereby controls erythroid differentiation.
19369647 Observational study of gene-disease association. (HuGE Navigator)
19236006 An isolated HMG box A domain from human HMGB2 does not enhance DNA flexibility. Substitution of a small number of cationic residues from the N-terminal leader of a functional yeast box B protein, Nhp6Ap, confers the ability to enhance DNA flexibility.
19223331 Results suggest a mechanism of up-regulation of cellular expression of topo IIalpha by HMGB1/2 in pRb-negative cells by modulation of binding of transcription factor NF-Y to the topo IIalpha promoter.
19139395 In human and murine cartilage, there is an aging-related loss of HMGB2 expression, ultimately leading to its complete absence.
17964600 single and double box proteins increase DNA flexibility and stability, albeit both effects are achieved at much lower protein concentrations for the double box.
17406091 HMG2 was determined in humans.
15833996 biophysical analysis of HMG domain from human HMGB2 binding to DNA
14739282 interaction of estrogen receptor alpha and beta with HMGB requires the C-terminal extension (CTE) of the estrogen receptor alpha and beta DNA binding domain
12555809 binds specifically to the first AT-rich region flanking the hypersensitive site 2 core sequence of the human beta-globin gene locus control region
11909973 HMG2 interacts with the nucleosome assembly protein SET and is a target of the cytotoxic T-lymphocyte protease granzyme A.
11748232 ubiquitously expressed HMGB1 and HMGB2 have potential to cell- and promoter-specifically down- or up-regulate in vivo transcriptional activity of different members of the p53 family

AA Sequence

MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKAR      1 - 70
YDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKD     71 - 140
KQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE     141 - 209
//

Text Mined References (70)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25937287 2015 Antisense RNA controls LRP1 Sense transcript expression through interaction with a chromatin-associated protein, HMGB2.
25416956 2014 A proteome-scale map of the human interactome network.
25327479 2015 Silencing of high-mobility group box 2 (HMGB2) modulates cisplatin and 5-fluorouracil sensitivity in head and neck squamous cell carcinoma.
25284587 2015 Genomic interaction between ER and HMGB2 identifies DDX18 as a novel driver of endocrine resistance in breast cancer cells.
25060178 2014 The combination of a nuclear HMGB1-positive and HMGB2-negative expression is potentially associated with a shortened survival in patients with pancreatic ductal adenocarcinoma.
24684392 2014 Association of HMGB1 and HMGB2 genetic polymorphisms with lung cancer chemotherapy response.
24531895 2014 A systematic nomenclature for the redox states of high mobility group box (HMGB) proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23877675 2013 Antimicrobial activity of high-mobility-group box 2: a new function to a well-known protein.
23828241 2013 High-mobility group box 2 is associated with prognosis of glioblastoma by promoting cell viability, invasion, and chemotherapeutic resistance.
23255232 2013 High-mobility group box 2 (HMGB2) modulates radioresponse and is downregulated by p53 in colorectal cancer cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23143110 2013 Single-molecule kinetics reveal microscopic mechanism by which High-Mobility Group B proteins alter DNA flexibility.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22644337 2012 Anti-high mobility group box 1 and box 2 non-histone chromosomal proteins (HMGB1/HMGB2) antibodies and anti-Saccharomyces cerevisiae antibodies (ASCA): accuracy in differentially diagnosing UC and CD and correlation with inflammatory bowel disease phenotype.
21890638 2011 Expression patterns and function of chromatin protein HMGB2 during mesenchymal stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20851854 2010 Overexpression of high-mobility group box 2 is associated with tumor aggressiveness and prognosis of hepatocellular carcinoma.
20123072 HMGB proteins: interactions with DNA and chromatin.
20036050 2010 HMGB2 stabilizes p53 by interfering with E6/E6AP-mediated p53 degradation in human papillomavirus-positive HeLa cells.
19965638 2010 High-mobility group protein HMGB2 regulates human erythroid differentiation through trans-activation of GFI1B transcription.
19811285 2009 High mobility group B2 is secreted by myeloid cells and has mitogenic and chemoattractant activities similar to high mobility group B1.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19522541 2009 Nucleosome binding properties and Co-remodeling activities of native and in vivo acetylated HMGB-1 and HMGB-2 proteins.
19369647 2009 Identification of potentially damaging amino acid substitutions leading to human male infertility.
19236006 2009 Enhancement of DNA flexibility in vitro and in vivo by HMGB box A proteins carrying box B residues.
19223331 2009 HMGB1 and HMGB2 proteins up-regulate cellular expression of human topoisomerase IIalpha.
19139395 2009 Aging-related loss of the chromatin protein HMGB2 in articular cartilage is linked to reduced cellularity and osteoarthritis.
18413230 2008 Transient HMGB protein interactions with B-DNA duplexes and complexes.
18239742 2008 High mobility group proteins stimulate DNA cleavage by apoptotic endonuclease DFF40/CAD due to HMG-box interactions with DNA.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17964600 2007 HMGB binding to DNA: single and double box motifs.
17406091 2006 Recent integrations of mammalian Hmg retropseudogenes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15833996 2005 Dual binding modes for an HMG domain from human HMGB2 on DNA.
15504738 2005 Genes affecting the cell cycle, growth, maintenance, and drug sensitivity are preferentially regulated by anti-HER2 antibody through phosphatidylinositol 3-kinase-AKT signaling.
15496585 2004 Conformational difference in HMGB1 proteins of human neutrophils and lymphocytes revealed by epitope mapping of a monoclonal antibody.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14739282 2004 The role of the C-terminal extension (CTE) of the estrogen receptor alpha and beta DNA binding domain in DNA binding and interaction with HMGB.
14729942 2004 Identification of phosphoproteins and their phosphorylation sites in the WEHI-231 B lymphoma cell line.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12925773 2003 Association of chromatin proteins high mobility group box (HMGB) 1 and HMGB2 with mitotic chromosomes.
12555809 2002 High-mobility group protein 2 may be involved in the locus control region regulation of the beta-globin gene cluster.
12524539 2003 Cleaving the oxidative repair protein Ape1 enhances cell death mediated by granzyme A.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12062430 2002 Identification of casein kinase Ialpha interacting protein partners.
11909973 2002 HMG2 interacts with the nucleosome assembly protein SET and is a target of the cytotoxic T-lymphocyte protease granzyme A.
11748232 2002 HMGB1 and HMGB2 cell-specifically down-regulate the p53- and p73-dependent sequence-specific transactivation from the human Bax gene promoter.
11099378 2000 Phage display screening reveals an association between germline-specific transcription factor Oct-4 and multiple cellular proteins.
10490593 1999 The RAG1 homeodomain recruits HMG1 and HMG2 to facilitate recombination signal sequence binding and to enhance the intrinsic DNA-bending activity of RAG1-RAG2.
9722660 1998 High mobility group proteins 1 and 2 can function as DNA-binding regulatory components for DNA-dependent protein kinase in vitro.
9671457 1998 High-mobility group chromatin proteins 1 and 2 functionally interact with steroid hormone receptors to enhance their DNA binding in vitro and transcriptional activity in mammalian cells.
9636147 1998 Chromatin components as part of a putative transcriptional repressing complex.
9600082 1998 Non-histone chromosomal proteins HMG1 and 2 enhance ligation reaction of DNA double-strand breaks.
9010268 1997 Novel autoantigens of perinuclear anti-neutrophil cytoplasmic antibodies (P-ANCA) in ulcerative colitis: non-histone chromosomal proteins, HMG1 and HMG2.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8824816 1996 Mapping of the human HMG2 gene to 4q31.
8339930 1993 The nonspecific DNA-binding and -bending proteins HMG1 and HMG2 promote the assembly of complex nucleoprotein structures.
8226934 1993 Localization of the binding region of high mobility group protein 2 to cisplatin-damaged DNA.
7797075 1995 Activation of the TFIID-TFIIA complex with HMG-2.
7720710 1995 High mobility group protein 2 functionally interacts with the POU domains of octamer transcription factors.
3697355 1986 Identification of the core-histone-binding domains of HMG1 and HMG2.
1754403 1991 Sequence of human HMG2 cDNA.
1551873 1992 Structure of a gene coding for human HMG2 protein.
1475204 1992 A human HMG2 cDNA with a novel 3'-untranslated region.
978439 1976 Pharmaceutical applications of solid dispersion systems: dissolution of griseofulvin-succinic acid eutectic mixture.