1. Home
  2. Targets
  3. transcription factor
  4. DNA binding protein
  5. chromatin/chromatin-binding protein
  6. SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related

Tbio SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related

Required for correct progression through G2 phase of the cell cycle and entry into mitosis. Required for RCOR1/CoREST mediated repression of neuronal specific gene promoters.

 Comments

Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.28
PubTator Score 11.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (18)

Disease log2 FC p
Multiple myeloma 1.109 5.6e-03
astrocytoma 1.500 3.3e-24
posterior fossa group B ependymoma 2.000 5.9e-18
psoriasis 1.400 5.9e-04
glioblastoma 1.900 2.3e-07
oligodendroglioma 1.200 2.7e-11
osteosarcoma 1.553 2.2e-03
sonic hedgehog group medulloblastoma 1.900 9.3e-08
atypical teratoid / rhabdoid tumor 2.000 1.6e-10
primitive neuroectodermal tumor 1.400 1.4e-03
intraductal papillary-mucinous adenoma (... 1.100 8.0e-03
intraductal papillary-mucinous carcinoma... 1.900 5.0e-04
intraductal papillary-mucinous neoplasm ... 1.200 2.9e-02
pediatric high grade glioma 1.600 2.7e-07
subependymal giant cell astrocytoma 1.211 2.3e-02
COPD -1.100 1.1e-03
ovarian cancer 2.300 1.3e-05
Down syndrome 1.100 9.9e-04

Synonym

Accession Q9P0W2 A6NMS5 D6W616 Q6IBP8 Q8NBD5 Q9HD21 Q9Y491 Q9Y4A2 SMARCE1-related protein
Symbols SOXL
HMGX2
BRAF25
BRAF35
HMGXB2
PP7706
pp8857
SMARCE1r

Gene

HMG20B

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (14)

See all...

 GO Function (2)

 GO Component (2)

 GO Process (7)

 Compartment GO Term (21)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (5)

Protein-protein Interaction (10)

HIST2H4A   PHF21A   RCOR1   HDAC1   HDAC2   KDM1A   GSE1   RCOR2   RCOR3   HMG20A  

Gene RIF (9)

PMID Text
25486196 Fresh insight into the mechanism by which the HMG20b-BRCA2 complex controls mitotic cell division, and implicate heterozygous HMG20b mutations affecting cytokinesis regulation in the genesis of human cancers.
22570500 HMG20B/BRAF35 forms heterodimers with HMG20A/iBRAF. Heterodimerization impairs HMG20B/BRAF35 sumoylation and interaction with the LSD1-CoREST complex.
21399666 a novel function for HMG20b in cytokinesis is regulated by its interaction with the BRC repeats of BRCA2
20530487 beta-dystrobrevin interacts with the HMG20 proteins iBRAF and BRAF35
17961134 we have examined Sox gene expression in 60 human primary gliomas. Transcripts from each of the six group E and group D genes were expressed in gliomas of various types and malignancy grades
12809554 Results demonstrating association of BRAF35 with KIF4 through the interaction of their respective alpha-helical coiled-coil domains is unique so far in mammals.
12083779 molecular Cloning of BRAF25, an alternatively spliced protein of BRAF35
12032298 complex containing histone deacetylase complex containing histone deacetylase mediates repression of neuronal-specific genes.
11997092 molecular cloning, nucleotide and amino acid sequencing

AA Sequence 

MSHGPKQPGAAAAPAGGKAPGQHGGFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGP      1 - 70
KAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKELRAYQQS     71 - 140
EAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGFSTFDVPIFTEEFLDQNKAREAELRRLRKMN    141 - 210
VAFEEQNAVLQRHTQSMSSARERLEQELALEERRTLALQQQLQAVRQALTASFASLPVPGTGETPTLGTL    211 - 280
DFYMARLHGAIERDPAQHEKLIVRIKEILAQVASEHL                                     281 - 317
//

Text Mined References (22)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25486196 2014 A cancer-associated mutation inactivates a region of the high-mobility group protein HMG20b essential for cytokinesis.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22570500 2012 Control of neuronal differentiation by sumoylation of BRAF35, a subunit of the LSD1-CoREST histone demethylase complex.
21399666 2011 A mitotic function for the high-mobility group protein HMG20b regulated by its interaction with the BRC repeats of the BRCA2 tumor suppressor.
20530487 2010 The interaction with HMG20a/b proteins suggests a potential role for beta-dystrobrevin in neuronal differentiation.
17961134 2007 Expression of SoxE and SoxD genes in human gliomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12809554 2003 Association of human kinesin superfamily protein member 4 with BRCA2-associated factor 35.
12493763 2003 A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12083780 2002 Immunohistological detection of BRAF25 in human prostate tumor and cancer specimens.
12083779 2002 Cloning a cDNA encoding an alternatively spliced protein of BRCA2-associated factor 35.
12032298 2002 A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes.
11997092 2002 Characterization of human SMARCE1r high-mobility-group protein.
11207365 2001 A human BRCA2 complex containing a structural DNA binding component influences cell cycle progression.
10773667 2000 HMG20A and HMG20B map to human chromosomes 15q24 and 19p13.3 and constitute a distinct class of HMG-box genes with ubiquitous expression.
10486208 1999 Cloning, chromosomal location, and expression analysis of murine Smarce1-related, a new member of the high-mobility 365 group gene family.