Property Summary

NCBI Gene PubMed Count 13
PubMed Score 23.53
PubTator Score 4.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 1.7e-02
ependymoma -1.400 2.7e-02
malignant mesothelioma 1.300 1.1e-06
osteosarcoma -1.646 2.7e-04
ovarian cancer 1.300 6.3e-05
pituitary cancer 1.100 7.3e-06
subependymal giant cell astrocytoma -1.212 4.5e-03

Gene RIF (5)

AA Sequence

MCGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERII      1 - 70
APMRWGLVPSWFKESDPSKLQFNTTNCRSDTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPY     71 - 140
FIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIH    141 - 210
HRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRA    211 - 280
SGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKREKEEEPVAKR    281 - 350
PYSQ                                                                      351 - 354
//

Text Mined References (19)

PMID Year Title