Property Summary

NCBI Gene PubMed Count 23
PubMed Score 30.31
PubTator Score 21.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
Alzheimer's disease 1.100 2.3e-02
breast carcinoma -1.200 3.3e-02
ductal carcinoma in situ -1.100 3.5e-02
lung adenocarcinoma -1.200 4.9e-08
malignant mesothelioma -1.200 5.5e-06
oligodendroglioma 1.200 2.5e-03
ovarian cancer -1.400 2.9e-06
pancreatic cancer -1.200 1.2e-02
primary pancreatic ductal adenocarcinoma -1.239 2.2e-02

Gene RIF (11)

AA Sequence

MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDKFGRRSSYGGS      1 - 70
SYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHAN     71 - 140
SMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVVAQVTGISQSRISHWLLQQG    141 - 210
SDLSEQKKRAFYRWYQLEKTNPGATLSMRPAPIPIEDPEWRQTPPPVSATSGTFRLRRGSRFTWRKECLA    211 - 280
VMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILES    281 - 350
HGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDDD    351 - 420
//

Text Mined References (32)

PMID Year Title