Property Summary

NCBI Gene PubMed Count 36
PubMed Score 70.23
PubTator Score 50.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
nephrosclerosis 1.925 1.6e-04
pancreatic cancer 1.500 2.8e-03
malignant mesothelioma -2.700 3.8e-08
psoriasis 1.400 1.1e-03
intraductal papillary-mucinous adenoma (... -1.100 5.4e-04
intraductal papillary-mucinous carcinoma... -1.100 1.2e-03
interstitial cystitis 1.200 4.3e-03
group 3 medulloblastoma 3.000 1.3e-04
pancreatic carcinoma 1.500 2.8e-03
subependymal giant cell astrocytoma 1.128 2.1e-02
lung adenocarcinoma -1.228 8.7e-12
ovarian cancer 2.000 2.3e-04

Gene RIF (19)

PMID Text
23888188 Studies have identified HLX as a novel key transcription factor involved in the regulation of early hematopoiesis and AML pathogenesis.
23243425 The expression levels of Hlx, T-bet, and IFN-gamma were significantly decreased.
22989111 Data suggest that HLX1 is downstream mediator of hepatocyte growth factor- (HGF-) induced cell survival, cell proliferation, and invasive properties of trophoblast cells; thus, both HGF and HLX1 appear to be involved in normal placental development.
22897850 This study identifies HLX as a key regulator in immature hematopoietic and leukemia cells and as a prognostic marker and therapeutic target in acute myeloid leukemia.
22303482 This study investigated the influence of TBX21 and HLX1 single nucleotide polymorphisms (SNPs), which have previously been shown to be associated with asthma, on T(H)1/T(H)2 lineage cytokines at birth.
22014209 a functional polymorphism in HLX in combination with the TBX21 polymorphism is also associated with the prognosis of Graves' disease.
21224470 These data suggest that HLX may function to balance attractive with repulsive vessel guidance by up-regulating UNC5B and to down-modulate sprouting under normoxic conditions.
20554918 HLX is a mediator of HGF/c-met-dependent trophoblast migration but is not involved in the regulation of trophoblast invsion.
20008130 Cell cycle regulatory genes RB1, MYC, CCNB1, ELK1, JUN, and CDKN1C, which control important trophoblast cell functions, are targets of HLX.
19459883 Sequence variants in the HLX gene at chromosome 1q41-1q42 in patients with diaphragmatic hernia
19362357 A risk score model indicates that TBX21 and HLX1 polymorphisms may have synergistic effects on asthma risk.
19362357 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19295429 gene variants influence the development of childhood asthma
19038437 polymorphisms in the HLX1 gene increase the risk for childhood asthma.
18402755 HLX is primarily expressed in cytotrophoblast cell types in the human placenta and propose that HLX is involved in cytotrophoblast proliferation and downregulation of cell differentiation
17532041 We have shown for the first time that a homeobox gene, HLX1, is a downstream effector gene of CSF-1, that HLX1 regulates placental cell proliferation and that CSF-1 acts, at least in part, through HLX1 to control cell proliferation.
17110450 Hlx expression in activated NK cells temporally controls and limits the monokine-induced production of interferon-gamma.
16902145 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16436665 Decreased HLX1 expression is associated with idiopathic fetal growth restriction

AA Sequence

MFAAGLAPFYASNFSLWSAAYCSSAGPGGCSFPLDPAAVKKPSFCIADILHAGVGDLGAAPEGLAGASAA      1 - 70
ALTAHLGSVHPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLSAAYHHHHPQQQQQQQQPQQQQPPP     71 - 140
PPRAGALQPPASGTRVVPNPHHSGSAPAPSSKDLKFGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAG    141 - 210
VHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSR    211 - 280
AVFSNLQRKGLEKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKDKDKEAGEK    281 - 350
PSGGAPAADGEQDERSPSRSEGEAESESSDSESLDMAPSDTERTEGSERSLHQTTVIKAPVTGALITASS    351 - 420
AGSGGSSGGGGNSFSFSSASSLSSSSTSAGCASSLGGGGASELLPATQPTASSAPKSPEPAQGALGCL      421 - 488
//

Text Mined References (39)

PMID Year Title
23888188 2012 HLX in AML: novel prognostic and therapeutic target.
23455154 2013 Interplay between Homeobox proteins and Polycomb repressive complexes in p16INK?a regulation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23243425 2012 Downregulation of Hlx closely related to the decreased expressions of T-bet and Runx3 in patients with gastric cancer may be associated with a pathological event leading to the imbalance of Th1/Th2.
22989111 2012 Hepatocyte growth factor regulates HLX1 gene expression to modulate HTR-8/SVneo trophoblast cells.
22897850 2012 H2.0-like homeobox regulates early hematopoiesis and promotes acute myeloid leukemia.
22303482 2012 TBX21 and HLX1 polymorphisms influence cytokine secretion at birth.
22014209 2012 Functional polymorphisms in TBX21 and HLX are associated with development and prognosis of Graves' disease.
21224470 2011 The VEGF-regulated transcription factor HLX controls the expression of guidance cues and negatively regulates sprouting of endothelial cells.
20554918 2010 Homeobox gene HLX is a regulator of HGF/c-met-mediated migration of human trophoblast-derived cell lines.
20008130 2010 Downstream targets of homeobox gene HLX show altered expression in human idiopathic fetal growth restriction.
19459883 2009 Sequence variants in the HLX gene at chromosome 1q41-1q42 in patients with diaphragmatic hernia.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19362357 2009 TBX21 gene variants increase childhood asthma risk in combination with HLX1 variants.
19295429 2009 Gene-environmental interaction in the development of atopic asthma: new developments.
19038437 2009 HLX1 gene variants influence the development of childhood asthma.
18402755 2008 Homeodomain protein HLX is expressed primarily in cytotrophoblast cell types in the early pregnancy human placenta.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17532041 2007 Homeobox gene HLX1 is a regulator of colony stimulating factor-1 dependent trophoblast cell proliferation.
17110450 2007 Hlx homeobox transcription factor negatively regulates interferon-gamma production in monokine-activated natural killer cells.
16902145 2006 Polymorphisms in human homeobox HLX1 and DNA repair RAD51 genes increase the risk of therapy-related acute myeloid leukemia.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16436665 2006 Homeobox gene HLX1 expression is decreased in idiopathic human fetal growth restriction.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9665637 1998 Homeobox genes DLX4 and HB24 are expressed in regions of epithelial-mesenchymal cell interaction in the adult human endometrium.
9073066 1997 Isolation and identification of homeobox genes from the human placenta including a novel member of the Distal-less family, DLX4.
8095486 1993 Linkage localization of TGFB2 and the human homeobox gene HLX1 to chromosome 1q.
8094082 1993 A human homeobox gene, HB24, inhibits development of CD4+ T cells and impairs thymic involution in transgenic mice.
7806220 1994 Genomic structure, promoter sequence, and revised translation of human homeobox gene HLX1.
7680402 1993 High expression of two diverged homeobox genes, HB24 and HB9, in acute leukemias: molecular markers of hematopoietic cell immaturity.
1712647 1991 Selective expression of two homeobox genes in CD34-positive cells from human bone marrow.
1676597 1991 Cloning of a human homeobox gene that resembles a diverged Drosophila homeobox gene and is expressed in activated lymphocytes.
1672660 1991 Novel murine homeo box gene on chromosome 1 expressed in specific hematopoietic lineages and during embryogenesis.
1375114 1992 A diverged homeobox gene is involved in the proliferation and lineage commitment of human hematopoietic progenitors and highly expressed in acute myelogenous leukemia.
1349016 1992 Stable expression of HB24, a diverged human homeobox gene, in T lymphocytes induces genes involved in T cell activation and growth.
1283323 1992 Two diverged human homeobox genes involved in the differentiation of human hematopoietic progenitors map to chromosome 1, bands q41-42.1.