Property Summary

NCBI Gene PubMed Count 31
PubMed Score 18.21
PubTator Score 190.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Gout 93 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Leukemia 88 3.196 1.6

Expression

  Differential Expression (34)

Disease log2 FC p
astrocytic glioma -2.800 4.5e-03
ependymoma -3.400 4.6e-03
oligodendroglioma -1.900 2.0e-11
esophageal adenocarcinoma -2.000 3.1e-02
psoriasis -1.600 2.7e-03
cutaneous lupus erythematosus -2.500 1.2e-04
glioblastoma -4.200 1.6e-06
osteosarcoma -2.193 4.6e-03
group 3 medulloblastoma -3.100 4.7e-03
periodontitis -1.100 9.8e-21
atypical teratoid / rhabdoid tumor -5.100 4.5e-13
medulloblastoma, large-cell -4.200 5.8e-05
primitive neuroectodermal tumor -4.300 4.1e-05
Atopic dermatitis -1.300 2.7e-04
adrenocortical carcinoma -1.462 4.8e-02
pancreatic ductal adenocarcinoma liver m... -2.225 3.0e-03
non-small cell lung cancer -2.218 4.0e-23
intraductal papillary-mucinous adenoma (... -1.400 1.8e-03
intraductal papillary-mucinous carcinoma... -1.700 2.2e-03
intraductal papillary-mucinous neoplasm ... -1.800 1.5e-02
colon cancer -3.800 3.1e-05
lung cancer -4.500 4.5e-06
breast carcinoma -2.000 1.5e-37
Breast cancer -3.100 2.3e-02
interstitial cystitis -2.300 9.9e-04
lung adenocarcinoma -2.200 1.7e-08
pediatric high grade glioma -3.200 1.7e-05
pilocytic astrocytoma -2.300 2.3e-06
subependymal giant cell astrocytoma -3.142 4.4e-02
invasive ductal carcinoma -3.800 5.2e-05
ductal carcinoma in situ -2.900 5.1e-05
ovarian cancer -2.300 3.5e-12
pituitary cancer 1.800 8.6e-08
head and neck cancer -1.500 6.6e-03

Gene RIF (12)

PMID Text
26214592 Drug response profiling of matched patient-derived xenografts revealed a distinct profile for TCF3-HLF ALL with resistance to conventional chemotherapeutics but sensitivity to glucocorticoids.
23415677 ectopic expression of HLF, an established transcription factor that cycles with circadian rhythms, can recapitulate many features associated with circadian-dependent physiological variation.
21072044 both Lmo2 and Bcl-2 are required for the action of E2A-HLF in leukemogenesis
20519628 E2A-HLF promotes cell survival of t(17;19)- acute lymphoblastic leukemia cells by aberrantly up-regulating LMO2 expression
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18239067 Activation of the thyroid hormone receptor beta/retinoid X receptor alpha heterodimer by T(3) stimulated expression of the hepatic leukemia factor, which increases HIF-1alpha gene expression.
17183364 In childhood acute lymphoblastic leukemia and hypercalcemia, translocation was observed in E2A-HLF fusion protein.
16215946 The patients with immunophenotype of Pre-B-acute lymphoblastic leukemia were found to carry: E2A/PBX1 and E2A/HLF.
16206189 The E2A-HLF-mediated over-expression of ABCB1 may play a role in the clinical phenotype of ALLs with a t(17;19), suggesting pharmacologic modulation of ABCB1 activity as a rational therapeutic strategy for this chemotherapy resistant subtype of ALL.
15070701 E2A-HLF induces annexin II by substituting for cytokines that activate downstream pathways of Ras
12700034 Evidence pertaining to leukemogenesis by the well-characterized oncogenic fusion protein E2A-HLF is reviewed and its mechanistic implications are considered.
7556072 The authors characterize variants of rat HLF, including use of two alternative promoters and a non-AUG translation initiation site that has not been confirmed in human.

AA Sequence

MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLW      1 - 70
DKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPS     71 - 140
PNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPM    141 - 210
IKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGK    211 - 280
CKNILAKYEARHGPL                                                           281 - 295
//

Text Mined References (33)

PMID Year Title
26214592 2015 Genomics and drug profiling of fatal TCF3-HLF-positive acute lymphoblastic leukemia identifies recurrent mutation patterns and therapeutic options.
24236485 2013 Genome-wide association study in NSAID-induced acute urticaria/angioedema in Spanish and Han Chinese populations.
23415677 2013 Hepatic leukemia factor promotes resistance to cell death: implications for therapeutics and chronotherapy.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
21072044 2011 The E2A-HLF oncogenic fusion protein acts through Lmo2 and Bcl-2 to immortalize hematopoietic progenitors.
20519628 2010 Aberrant induction of LMO2 by the E2A-HLF chimeric transcription factor and its implication in leukemogenesis of B-precursor ALL with t(17;19).
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
18239067 2008 Thyroid hormone induces hypoxia-inducible factor 1alpha gene expression through thyroid hormone receptor beta/retinoid x receptor alpha-dependent activation of hepatic leukemia factor.
17183364 2007 Hypercalcemia in childhood acute lymphoblastic leukemia: frequent implication of parathyroid hormone-related peptide and E2A-HLF from translocation 17;19.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16215946 2005 [Detection of fusion genes resulting from chromosome abnormalities in childhood acute lymphoblastic leukemia].
16206189 2006 ABCB1 over-expression and drug-efflux in acute lymphoblastic leukemia cell lines with t(17;19) and E2A-HLF expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15070701 2004 Regulation of annexin II by cytokine-initiated signaling pathways and E2A-HLF oncoprotein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12700034 2003 E2A basic helix-loop-helix transcription factors in human leukemia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10216071 1999 Expression of E2A-HLF chimeric protein induced T-cell apoptosis, B-cell maturation arrest, and development of acute lymphoblastic leukemia.
10202154 1999 Molecular mechanisms of transcription activation by HLF and HIF1alpha in response to hypoxia: their stabilization and redox signal-induced interaction with CBP/p300.
10073576 1999 Enhanced binding of HLF/DBP heterodimers represents one mechanism of PAR protein transactivation of the factor VIII and factor IX genes.
9742120 1998 The AD1 and AD2 transactivation domains of E2A are essential for the antiapoptotic activity of the chimeric oncoprotein E2A-HLF.
9704006 1998 Transcriptionally active heterodimer formation of an Arnt-like PAS protein, Arnt3, with HIF-1a, HLF, and clock.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8639829 1996 The proto-oncogene HLF and the related basic leucine zipper protein TEF display highly similar DNA-binding and transcriptional regulatory properties.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8608207 1996 Chromosomal translocations involving the E2A gene in acute lymphoblastic leukemia: clinical features and molecular pathogenesis.
8164688 1994 DNA-binding specificity and trans-activating potential of the leukemia-associated E2A-hepatic leukemia factor fusion protein.
8065331 1994 DNA-binding and transcriptional regulatory properties of hepatic leukemia factor (HLF) and the t(17;19) acute lymphoblastic leukemia chimera E2A-HLF.
7556072 1995 The rat hepatic leukemia factor (HLF) gene encodes two transcriptional activators with distinct circadian rhythms, tissue distributions and target preferences.
1516826 1992 Hlf, a novel hepatic bZIP protein, shows altered DNA-binding properties following fusion to E2A in t(17;19) acute lymphoblastic leukemia.
1386162 1992 Fusion of the leucine zipper gene HLF to the E2A gene in human acute B-lineage leukemia.