Property Summary

NCBI Gene PubMed Count 59
PubMed Score 71.93
PubTator Score 55.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Protein-protein Interaction (2)

Gene RIF (96)

AA Sequence

MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPRE      1 - 70
PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYD     71 - 140
GKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHV    141 - 210
AHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTC    211 - 280
HVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV        281 - 346
//

Text Mined References (60)

PMID Year Title