Tbio | HLA class I histocompatibility antigen, alpha chain E |
Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.
HLA-E belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-E binds a restricted subset of peptides derived from the leader peptides of other class I molecules. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. [provided by RefSeq, Jul 2008]
HLA-E belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-E binds a restricted subset of peptides derived from the leader peptides of other class I molecules. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Parapsoriasis | 6 | 0.0 | 0.0 |
Disease | Target Count |
---|---|
Bipolar Disorder | 666 |
Nonorganic psychosis | 84 |
Psychotic Disorders | 151 |
Schizophrenia | 1160 |
Disease | Target Count | P-value |
---|---|---|
lung carcinoma | 2843 | 4.3e-21 |
non-small cell lung cancer | 2890 | 7.9e-15 |
juvenile dermatomyositis | 1187 | 9.4e-13 |
malignant mesothelioma | 3232 | 1.5e-07 |
Duchenne muscular dystrophy | 601 | 3.1e-07 |
medulloblastoma, large-cell | 6241 | 3.9e-06 |
lung adenocarcinoma | 2716 | 1.2e-05 |
ovarian cancer | 8520 | 1.3e-05 |
Astrocytoma, Pilocytic | 3081 | 1.6e-05 |
osteosarcoma | 7950 | 3.5e-05 |
group 4 medulloblastoma | 1855 | 4.5e-05 |
psoriasis | 6694 | 2.0e-04 |
limb girdle muscular dystrophy 2I | 32 | 2.4e-04 |
lung cancer | 4740 | 3.9e-04 |
pituitary cancer | 1972 | 1.1e-03 |
diabetes mellitus | 1728 | 1.5e-03 |
subependymal giant cell astrocytoma | 2287 | 1.7e-03 |
Multiple myeloma | 1332 | 2.0e-03 |
glioblastoma | 5792 | 2.4e-03 |
Becker muscular dystrophy | 191 | 2.8e-03 |
active Crohn's disease | 922 | 3.5e-03 |
astrocytoma | 1146 | 4.4e-03 |
active ulcerative colitis | 764 | 7.0e-03 |
dermatomyositis | 966 | 8.1e-03 |
Disease | log2 FC | p |
---|---|---|
active Crohn's disease | 1.430 | 3.5e-03 |
active ulcerative colitis | 1.086 | 7.0e-03 |
astrocytoma | 1.900 | 4.4e-03 |
Astrocytoma, Pilocytic | 1.100 | 1.6e-05 |
Becker muscular dystrophy | 1.125 | 2.8e-03 |
dermatomyositis | 1.200 | 8.1e-03 |
diabetes mellitus | -1.100 | 1.5e-03 |
Duchenne muscular dystrophy | 1.390 | 3.1e-07 |
glioblastoma | 1.600 | 2.4e-03 |
group 4 medulloblastoma | -1.300 | 4.5e-05 |
juvenile dermatomyositis | 1.625 | 9.4e-13 |
limb girdle muscular dystrophy 2I | 1.293 | 2.4e-04 |
lung adenocarcinoma | -1.590 | 1.2e-05 |
lung cancer | -1.800 | 3.9e-04 |
lung carcinoma | -1.600 | 4.3e-21 |
malignant mesothelioma | -1.700 | 1.5e-07 |
medulloblastoma, large-cell | -1.700 | 3.9e-06 |
Multiple myeloma | 1.767 | 2.0e-03 |
non-small cell lung cancer | -1.477 | 7.9e-15 |
osteosarcoma | -3.090 | 3.5e-05 |
ovarian cancer | -1.700 | 1.3e-05 |
pituitary cancer | -1.100 | 1.1e-03 |
psoriasis | -1.400 | 2.0e-04 |
subependymal giant cell astrocytoma | 1.770 | 1.7e-03 |
MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRA 1 - 70 PWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYD 71 - 140 GKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHV 141 - 210 THHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTC 211 - 280 HVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSA 281 - 350 QGSESHSL 351 - 358 //