Property Summary

NCBI Gene PubMed Count 142
PubMed Score 0.00
PubTator Score 2384.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count
Hypersensitivity 63

Gene RIF (123)

PMID Text
26740600 HLA-DRB4 affects type 1 diabetes risk and islet autoantibodies.
25240755 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
25225671 The study identifies a region of focus for B and T cell responses to IA-2 in HLA-DR4 diabetic patients that may explain HLA associations of IA-2 autoantibodies.
24618287 HLA-DR4 codes for susceptibility to RF+ polyarticular JIA with a six-fold risk.
24505475 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23729440 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23537298 The HLA- DR4 gene was clearly associated with susceptibility to rheumatoid arthritis.
23454623 There was a strong association of aspirin resistant thrombophilia with expression of HLA-DRB4 and HLA-DQA1.
23170932 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
23152536 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
22860026 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
22808111 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
22671039 Heterozygosity of HLA-DRB3*01:01 and HLA-DRB4*01:01 as a potential predictor of fetal neonatal alloimmune thrombocytopenia.
22531795 There are no significant differences in the HLA-DRB3/B4/B5 homozygosity and heterozygosity rates between Korean males and females in both newborns and adults.
22041925 Data indicate that invariant NKT (iNKT) cell-mediated cytokine secretion in staphylococcal enterotoxin B (SEB)-challenged HLA-DR4-transgenic mice was CD1d-independent.
21922073 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
21778700 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
21556773 Elevated frequencies of HLA-DR4 and HLA-DR5 alleles were found in patients with idiopathic dilated cardiomyopathy compared with controls.
21410658 DRB4*01:08 is a novel HLA-DRB4 allele
21282506 HLA-DR14/DR7/DQ5 alleles significantly increase the risk for toxic shock syndrome, regardless of individual variations in T cell receptor variable region repertoires.
21085635 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
20606439 Observational study of gene-disease association. (HuGE Navigator)
20371654 IA2 positivity was associated with HLA-DR4/X and HLA-DR3/4 positivity, and hypothyroidism was linked to HLA-DR4/4. More females carried the HLA-DR4/4 genotype or were thyroid antibody positive.
20307907 Observational study of gene-disease association. (HuGE Navigator)
20193583 Observational study of gene-disease association. (HuGE Navigator)
20164547 Our results revealed HLA-DRB1*04 as predisposing factor in papillary thyroid carcinoma in Iranian population.
20012522 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
19922436 Observational study of gene-disease association. (HuGE Navigator)
19811438 primary biliary cirrhosis patients had a higher gene frequency of HLA-DR4 and DR1 compared to healthy controls and patients with overlap syndromes
19770068 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
19620308 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
19487610 Significant transmission disequilibrium for HLA-DR4 was seen (odds ratio, 4.67; 95% confidence interval, 1.34-16.24; P = .008) for transmissions from maternal grandparents to mothers of probands.
19449444 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
19235017 Observational study of gene-disease association. (HuGE Navigator)
19233472 Observational study of gene-disease association. (HuGE Navigator)
19223392 Observational study of gene-disease association. (HuGE Navigator)
19052923 associated with antiphospholipid syndrome
19035513 Thirty-eight percent of the B burgdorferi-infected DR4+/+CD28(-/-)MHCII(-/-) mice, but none of the B burgdorferi-infected CD28(-/-)MHCII(-/-) mice, remained arthritic post-antibiotic treatment
18945465 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
18846964 Observational study of gene-disease association. (HuGE Navigator)
18672082 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
18569076 Observational study of gene-disease association. (HuGE Navigator)
18523312 A model of mixed connective tissue disease has been developed in mice that express the transgene HLA-DRA*0101/DRB1*0401 in a fusion protein with U1-70-kDa ribonucleoprotein autoantigen.
18520346 Observational study of gene-disease association. (HuGE Navigator)
18223493 No predisposition to CAID was associated to HLA-DRB1*04 or DDB4*01 alleles.
18223493 Observational study of gene-disease association. (HuGE Navigator)
18053473 DRB1*04 may be a protective factor in paucibacillary leprosy.
17959659 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
17910142 Observational study of gene-disease association. (HuGE Navigator)
17893434 Observational study of gene-disease association. (HuGE Navigator)
17763415 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17763415 findings indicate that HLA-DRB4 is a genetic risk factor for the development of Churg-Strauss syndrome and increases the likelihood of development of vasculitic manifestations of the disease.
17507489 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
17491100 The shared epitope assessed on all HLA-DRB1 serotypic backgrounds except DR1 was associated with RA susceptibility. The presence of the shared epitope on DR4 is associated with greater RA susceptibility and certain disease-activity measures.
17431094 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
17411376 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
17310371 a diabetic intrauterine environment interacts with gene(s) marked by the type 1 diabetes susceptibility HLA DR4 alleles to increase fetal growth
17237562 Observational study of gene-disease association. (HuGE Navigator)
17182961 Observational study of gene-disease association. (HuGE Navigator)
17153701 Observational study of gene-disease association. (HuGE Navigator)
17106278 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17052889 HLA-DR and INS VNTR alleles mark both type 1 diabetes disease susceptibility and separate Caucasian parental subpopulations
17021767 Observational study of gene-disease association. (HuGE Navigator)
17021767 results for antigens and allele frequency of various HLA Loci in vitiligo patients and control subjects suggested that HLA-B7, Bw6, Cw6, Cw7, and DRB4*010101 could be susceptible to vitiligo
17002906 Observational study of gene-disease association. (HuGE Navigator)
16973583 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
16815190 The HLA-DR locus seems to be associated with the genetic susceptibility to develop SNP in Mexicans.
16629714 Genetic variation associated with type 1 diabetes in a Czech Republic population with childhood onset.
16405603 Observational study of gene-disease association. (HuGE Navigator)
15908298 Observational study of gene-disease association. (HuGE Navigator)
15902698 Observational study of gene-disease association. (HuGE Navigator)
15896200 analysis of coding sequences and haplotypic associations of HLA-B and HLA-DRB1 and association to HLA-DRB3 and HLA-DRB4 loci
15784911 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
15721314 HIP is an islet protein naturally processed and presented by HLA-DR4 molecules
15513680 No definite association was found between HLA-DR alleles and the risk of psoriasis or psoriatic arthritis.
15188377 DR1 and DR4 not only bind and present the same CII immunodominant peptide, but also stimulate a highly restricted subset of T cells.
15140072 Observational study of gene-disease association. (HuGE Navigator)
15055474 Observational study of gene-disease association. (HuGE Navigator)
15055474 Interaction between the HLA-DRB4 and CTLA-4 genes determines the thyroid function of TPO-positive goitrous Japanese Hashimoto's thyroiditis patients.
15046556 In patients with autoimmune thyroiditis the HLA-DR11 frequency was higher than control values, while in patients with autoimmune polyglandular syndrome type II, the HLA-DR3 frequency was found to be higher.
14677183 Observational study of gene-disease association. (HuGE Navigator)
14558083 differential expression of genes encoded within the RA-associated HLA-DR4 superhaplotype and within the neutral DR7 and DR9 superhaplotypes.
14508706 Observational study of gene-disease association. (HuGE Navigator)
12956878 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12859598 A novel allele of HLA-DRB4 was found.
12541760 Observational study of gene-disease association. (HuGE Navigator)
12427289 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
12392858 Observational study of genotype prevalence. (HuGE Navigator)
12391221 Comparison of HLA-DR4-associated peptides in neuroendocrine cells with those identified in lymphoblastoid B cells (LCLs) suggests that intracellular pathways allowing HLA-DR endogenous peptide processing are more efficient in endocrine cells than in LCLs.
12296785 Observational study of gene-disease association. (HuGE Navigator)
12230470 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
12209103 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12202216 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
12144632 Observational study of genotype prevalence. (HuGE Navigator)
12144077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12008082 Observational study of gene-disease association. (HuGE Navigator)
12008082 DRB4 was increased in males with childhood ALL compared to age- and sex-matched controls) and female patients. HLA-DRB4 is over-represented in high-risk patients. The HLA system may be a component of genetic leukemia susceptibility in male children only.
11997714 Observational study of gene-disease association. (HuGE Navigator)
11972878 Complete coding sequence of the HLA alleles DRB4*0103101 and DRB4*01033
11751963 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
11118314 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
11082517 Observational study of genotype prevalence. (HuGE Navigator)
10729169 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
10661406 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
9223324 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
9079699 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
8450224 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
8376762 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
8168144 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
8084338 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
7734415 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
7645219 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
7602119 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
7541827 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
7512597 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
3489470 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
2846691 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
2543930 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
1978941 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
1970352 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
1967269 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
1905983 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells
1869305 HIV-1 CA co-localizes with HLA-DR in human monocyte-derived dendritic cells

AA Sequence

MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYN      1 - 70
SDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQH     71 - 140
HNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMM    141 - 210
SPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS                  211 - 266
//

Text Mined References (150)

PMID Year Title
26740600 2016 Next-Generation Sequencing Reveals That HLA-DRB3, -DRB4, and -DRB5 May Be Associated With Islet Autoantibodies and Risk for Childhood Type 1 Diabetes.
25225671 2014 HLA-DR4-associated T and B cell responses to specific determinants on the IA-2 autoantigen in type 1 diabetes.
24618287 2014 HLA-DR typing in polyarticular juvenile idiopathic arthritis: a study from a tertiary care hospital in northern India.
23537298 2013 Study of association between HLA-DR4 and DR53 and autoantibody detection in rheumatoid arthritis.
23454623 2013 Aspirin insensitive thrombophilia: transcript profiling of blood identifies platelet abnormalities and HLA restriction.
22733780 2012 Mapping the HLA-DO/HLA-DM complex by FRET and mutagenesis.
22671039 2013 Compound heterozygosity of HLA-DRB3*01:01 and HLA-DRB4*01:01 as a potential predictor of fetal neonatal alloimmune thrombocytopenia.
22531795 2012 No gender differences in the frequencies of HLA-DRB3/B4/B5 heterozygotes in newborns and adults in Koreans.
22041925 2012 CD1d-independent activation of mouse and human iNKT cells by bacterial superantigens.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
21556773 2012 A meta-analysis of HLA-DR polymorphism and genetic susceptibility to idiopathic dilated cardiomyopathy.
21410658 2011 A novel HLA-DRB4 allele, DRB4*01:08, identified by sequence-based typing.
21282506 2011 Individual genetic variations directly effect polarization of cytokine responses to superantigens associated with streptococcal sepsis: implications for customized patient care.
20606439 2010 Visual hallucinations and HLA class II antigens in cortical dementia.
20371654 2010 HLA-DR genotypes influence age at disease onset in children and juveniles with type 1 diabetes mellitus.
20307907 2010 The impact of anti-HY responses on outcome in current and subsequent pregnancies of patients with recurrent pregnancy losses.
20193583 2009 [Association of hemorrhagic fever with renal syndrome and HLA-DRB allele polymorphisms in Han nationality, Hubei province].
20164547 2010 HLA-DR association in papillary thyroid carcinoma.
19922436 2010 Human leukocyte antigen association in idiopathic thrombotic thrombocytopenic purpura: evidence for an immunogenetic link.
19811438 2009 HLA-DR allele frequencies in Mexican mestizos with autoimmune liver diseases including overlap syndromes.
19533806 2009 CD74 in antigen presentation, inflammation, and cancers of the gastrointestinal tract.
19487610 2009 HLA-DR4 as a risk allele for autism acting in mothers of probands possibly during pregnancy.
19235017 2009 HLA risk markers for chronic myelogenous leukemia in Eastern Canada.
19233472 2009 Long-range linkage on chromosome 6p of VEGF, FKBP5, HLA and TNF alleles associated with transplant rejection.
19223392 2009 Association of HY-restricting HLA class II alleles with pregnancy outcome in patients with recurrent miscarriage subsequent to a firstborn boy.
19117940 2009 The HLA-DRalpha chain is modified by polyubiquitination.
19092054 2009 MHC class II transport at a glance.
19052923 2009 Clinical and laboratory features of the catastrophic antiphospholipid syndrome.
19035513 2008 Persistent arthritis in Borrelia burgdorferi-infected HLA-DR4-positive CD28-negative mice post-antibiotic treatment.
18846964 2008 [Human leukocyte antigen genes to genetic predisposition in diffuse panbronchiolitis].
18569076 2008 Anti-cofactor autoantibodies in systemic lupus erythematosus: prevalence, clinical and HLA class II associations.
18523312 2008 CD4+ T cells target epitopes residing within the RNA-binding domain of the U1-70-kDa small nuclear ribonucleoprotein autoantigen and have restricted TCR diversity in an HLA-DR4-transgenic murine model of mixed connective tissue disease.
18520346 2008 Associations of human leukocyte antigen DRB with resistance or susceptibility to HIV-1 infection in the Pumwani Sex Worker Cohort.
18305173 2008 MHC class II stabilization at the surface of human dendritic cells is the result of maturation-dependent MARCH I down-regulation.
18223493 2008 Frequency of concurrent autoimmune disorders in patients with autoimmune hepatitis: effect of age, gender, and genetic background.
18193213 2008 Variation analysis and gene annotation of eight MHC haplotypes: the MHC Haplotype Project.
18053473 2007 [Role of HLA-DR and HLA-DQ alleles in multibacillary leprosy and paucibacillary leprosy in the province of Chaco (Argentina)].
18046453 2008 MHC class II molecules on the move for successful antigen presentation.
18039812 2008 Nephropathy in type 1 diabetes is diminished in carriers of HLA-DRB1*04: the genetics of kidneys in diabetes (GoKinD) study.
17910142 2007 Antinuclear antibodies and HLA class II alleles in Jamaican patients with systemic lupus erythematosus.
17893434 2007 HLA class II allele and haplotype frequencies in Iranian patients with leukemia.
17763415 2007 HLA-DRB4 as a genetic risk factor for Churg-Strauss syndrome.
17491100 2007 Opposing effects of the D70 mutation and the shared epitope in HLA-DR4 on disease activity and certain disease phenotypes in rheumatoid arthritis.
17310371 2007 Fetal growth is increased by maternal type 1 diabetes and HLA DR4-related gene interactions.
17241953 2007 Autophagy in MHC class II presentation: sampling from within.
17237562 2006 HLA class II allele and haplotype frequencies in iranian patients with acute myelogenous leukemia and control group.
17182961 2006 HLA-DQA is associated with abdominal aortic aneurysms in the Belgian population.
17174751 2006 Group-specific amplification of cDNA from DRB1 genes. Complete coding sequences of partially defined alleles and identification of the new alleles DRB1*040602, DRB1*111102, DRB1*080103, and DRB1*0113.
17153701 2006 Association of immune responses to mycobacterium tuberculosis peptide antigens with host genetic factors.
17106278 2007 Human leukocyte antigen class I and class II allele frequencies and HIV-1 infection associations in a Chinese cohort.
17052889 2006 A genetic explanation for the rising incidence of type 1 diabetes, a polygenic disease.
17021767 2006 Association of HLA loci alleles and antigens in Saudi patients with vitiligo.
17002906 2006 Association of HLA-DR and -DQ genes with narcolepsy in Koreans: comparison with two control groups, randomly selected subjects and DRB1*1501-DQB1*0602--positive subjects.
16815190 2006 Association of HLA-DR3 and HLA-DR4 with sinonasal polyposis in Mexican Mestizos.
16690413 2005 The replacement mutation in HLA-DRB1*1211 affects a likely keystone position.
16634878 2006 Novel HLA-DRB1*1370 allele identified in a cord blood donor and her mother.
16629714 2006 Genetic association of type 1 diabetes in an Azerbaijanian population: the HLA-DQ, -DRB1*04, the insulin gene, and CTLA4.
16441501 2006 Identification of a novel HLA-DRB1*09 allele, DRB1*0904, in the Korean population, by sequence-based typing.
16405603 2006 Correlation between HLA and pityriasis rosea susceptibility in Brazilian blacks.
15982264 2005 Identification of a novel HLA-DRB1 allele (HLA-DRB1*111902*).
15908298 Association between psoriasis vulgaris and MHC-DRB, -DQB genes as a contribution to disease diagnosis.
15902698 2005 HLA-B, -DRB1/3/4/5, and -DQB1 gene polymorphisms in human immunodeficiency virus-related Kaposi's sarcoma.
15896200 2005 Complete coding sequences and haplotypic associations of HLA-B*0707, -B*1524, -B*4405, -B*4802, -DRB1*0409, -DRB1*0411, -DRB1*1115, -DRB1*1305, and the novel allele -DRB1*0709. Group-specific amplification of cDNA from DRB1 alleles associated to DRB3 and DRB4.
15795121 2005 HLA DR B1*04, *07-restricted epitopes on Keratin 17 for autoreactive T cells in psoriasis.
15730527 2005 A novel HLA-DRB1*09 allele, HLA-DRB1*090103*, isolated from the Han population of Guangdong, China.
15721314 2005 Analysis of eluted peptides from type 1 diabetes-susceptible HLA class II molecules identified novel islet protein, heparin/heparan sulfate-interacting protein.
15513680 2004 The effect of HLA-DR antigens on the susceptibility to, and clinical expression of psoriatic arthritis.
15496913 2004 Finishing the euchromatic sequence of the human genome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15191532 2004 Identification of two novel HLA-DRB1 alleles, DRB1*0903 and DRB1*1145.
15188377 2004 T cell receptors recognizing type II collagen in HLA-DR-transgenic mice characterized by highly restricted V beta usage.
15140072 2004 Difference in pathogenesis between vitiligo vulgaris and halo nevi associated with vitiligo is supported by an HLA association study.
15055474 2003 Interactions of HLA-DRB4 and CTLA-4 genes influence thyroid function in Hashimoto's thyroiditis in Japanese population.
15046556 2004 HLA antigen expression in autoimmune endocrinopathies.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14677183 2003 HLA class II alleles in systemic sclerosis patients with anti-RNA polymerase I/III antibody: associations with subunit reactivities.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14558083 2003 Differential expression of HLA class II genes associated with disease susceptibility and progression in rheumatoid arthritis.
14508706 2003 HLA-DRB1*1101: a significant risk factor for sarcoidosis in blacks and whites.
12956878 2003 Roles of HLA-B, HLA-C and HLA-DPA1 incompatibilities in the outcome of unrelated stem-cell transplantation.
12859598 2003 A new allele, HLA-DRB4*010304.
12541760 2001 [Linkage of allergic rhinitis with HLA-DRB alleles polymorphism].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12392858 2002 A comparison of HLA-DR and -DQ allele and haplotype frequencies in Trinidadian populations of African, South Asian, and mixed ancestry.
12391221 2002 HLA-DR4 molecules in neuroendocrine epithelial cells associate to a heterogeneous repertoire of cytoplasmic and surface self peptides.
12358860 2002 Complete cDNA sequences of the HLA-DRB1*0402 and DRB1*11041 alleles.
12296785 2002 HLA-A, B, Cw, DRB1, DRB3/4/5, DQB1 in German patients suffering from rapidly progressive periodontitis (RPP) and adult periodontitis (AP).
12230470 2002 Human macrophages accumulate HIV-1 particles in MHC II compartments.
12209103 2002 HLA-DQ8 and the HLA-DQ8-DR4 haplotype are positively associated with the hevein-specific IgE immune response in health care workers with latex allergy.
12202216 2002 HIV-1 gag polyprotein rescues HLA-DR intracellular transport in a human CD4+ cell line.
12144632 2002 HLA-DR and DQB1 gene polymorphism in the North-western Colombian population.
12144077 2002 HLA-DRB alleles and systemic lupus erythematosus in Jamaicans.
12121280 2002 A novel DRB1*09 allelic sequence in the Jing ethnic minority of China.
12008082 2002 A male-specific increase in the HLA-DRB4 (DR53) frequency in high-risk and relapsed childhood ALL.
11997714 2002 HLA class II DNA typing in a large series of European patients with systemic lupus erythematosus: correlations with clinical and autoantibody subsets.
11972878 2002 Specific amplification of the HLA-DRB4 gene from c-DNA. Complete coding sequence of the HLA alleles DRB4*0103101 and DRB4*01033.
11827988 2002 Adapters in lymphocyte signaling.
11751963 2002 Native HIV-1 Tat protein targets monocyte-derived dendritic cells and enhances their maturation, function, and antigen-specific T cell responses.
11684289 2001 Presentation of antigens by MHC class II molecules: getting the most out of them.
11532019 2001 PCR-RFLP typing detects new HLA-DRB1 alleles: DRB1*13022, DRB1*1336 and DRB1*1435.
11237011 2001 Initial sequencing and analysis of the human genome.
11118314 2000 Reciprocal modulation of transcriptional activities between HIV-1 Tat and MHC class II transactivator CIITA.
11082517 2000 A comparison of molecular HLA-DR and DQ allele profiles forming DR51-, DR52-, and DR53-related haplotypes in five ethnic Thai populations from mainland southeast Asia.
11048639 2000 The mechanism of phospholipase C-gamma1 regulation.
11034566 2000 Identification of a new HLA-DRB4 allele (DRB4*01033) by PCR-SSP and direct sequencing.
10717810 2000 HLA-restricted immune response to mycobacterial antigens: relevance to vaccine design.
10703621 2000 Detection of four novel alleles: DRB1*1130, DRB1*13072, DRB1*1315 and DRB1*1331.
10661406 2000 Tat competes with CIITA for the binding to P-TEFb and blocks the expression of MHC class II genes in HIV infection.
10551425 1999 Two DR2-associated novel alleles arose from the silent mutation of codon 72: DRB1*16012, DRB5*01012.
10425186 1999 Polymorphisms in the SOD2 and HLA-DRB1 genes are associated with nonfamilial idiopathic dilated cardiomyopathy in Japanese.
9952022 1999 Differential surface expression of HLA-DRB1 and HLA-DRB4 among peripheral blood cells of DR4 positive individuals.
9500545 1998 Recent origin of HLA-DRB1 alleles and implications for human evolution.
9354468 1997 X-ray crystal structure of HLA-DR4 (DRA*0101, DRB1*0401) complexed with a peptide from human collagen II.
9243754 1997 Identification of four new DR52-associated DRB1 alleles: DRB1*1424, *1425, *1323 and *1324.
9234493 1997 Identification of a new DRB4 allele (DRB4*0105) by sequence-based typing.
9223324 1997 Tat protein induces self-perpetuating permissivity for productive HIV-1 infection.
9162096 1997 Diversity associated with the second expressed HLA-DRB locus in the human population.
9098937 1997 A new silent mutation at codon 35 in exon 2 yielding DRB1*04012 allele.
9062971 1997 HLA-DRB4 genotyping by PCR-RFLP: diversity in the associations between HLA-DRB4 and DRB1 alleles.
9027964 1997 Diversity and evolution of the DRB1*03 family: description of DRB1*03022,*0307,*0308.
8775462 1995 Binding domain regulation of MHC class II molecule assembly, trafficking, fate, and function.
8598037 1996 Invariant chain structure and MHC class II function.
8344726 1993 Novel class II HLA-DRB4 and DPB1 alleles found in the Belgian population.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8085262 1994 A new HLA DR16 allele (DRB1*1604) with a short DR8 sequence.
7792759 1995 A description of a new DR allele, DRB1*1113.
7652736 1995 Direct sequencing of SSP-PCR-amplified cDNA to identify new alleles in the DR52-associated DRB1 group: identification of DRB1*1115, DRB1*1117 and DRB1*1319.
7528725 1995 A new DRB1*1202 allele (DRB1*12022) found in association with DQA1*0102 and DQB1*0602 in two black narcoleptic subjects.
3875800 1985 Sequence polymorphism of HLA DR beta 1 alleles relating to T-cell-recognized determinants.
3860851 1985 Structural organization of the DR subregion of the human major histocompatibility complex.
3596674 1987 Structural comparison of the genes of two HLA-DR supertypic groups: the loci encoding DRw52 and DRw53 are not truly allelic.
3476943 1987 Allelic variation in the DR subregion of the human major histocompatibility complex.
3467350 1987 Evolutionary and genetic implications of sequence variation in two nonallelic HLA-DR beta-chain cDNA sequences.
3458223 1986 Molecular diversity of HLA-DR4 haplotypes.
3372263 1988 Sequence analysis of HLA class II genes from insulin-dependent diabetic individuals.
3174462 1988 Identification of a novel DR beta cDNA clone.
3110774 1987 Sequence and evolution of HLA-DR7- and -DRw53-associated beta-chain genes.
3099214 1986 Polymorphism of human Ia antigens generated by reciprocal intergenic exchange between two DR beta loci.
3036826 1987 Class II genes of the human major histocompatibility complex. Organization and evolutionary relationship of the DR beta genes.
3020127 1986 Analysis of DR beta and DQ beta chain cDNA clones from a DR7 haplotype.
3015788 1986 Characterization of three HLA-DR beta genes isolated from an HLA-DR 3/4 insulin-dependent diabetic patient.
2592019 1989 Two distinct subtypes of the HLA-DRw12 haplotypes in the Japanese population detected by nucleotide sequence analysis and oligonucleotide genotyping.
2511168 1989 Shared class II MHC polymorphisms between humans and chimpanzees.
2466818 1989 First domain sequence of the HLA-DRB1 chain from two HLA-DRw14 homozygous typing cell lines: TEM (Dw9) and AMALA (Dw16).
2212675 1990 Two divergent routes of evolution gave rise to the DRw13 haplotypes.
2023919 1991 Allelic diversity is generated by intraexon sequence exchange at the DRB1 locus of primates.
1905983 1991 The HIV core protein p24 inhibits interferon-gamma-induced increase of HLA-DR and cytochrome b heavy chain mRNA levels in the human monocyte-like cell line THP1.
1612646 1992 Sequence analysis of three novel DRw14-DRB1 alleles.
1428007 1992 Mhc-DRB diversity of the chimpanzee (Pan troglodytes).
1358866 1992 Nucleotide sequences of the HLA-DRw12 and DRw8 B1 chains from an Australian aborigine.