Property Summary

NCBI Gene PubMed Count 194
PubMed Score 125.11
PubTator Score 126.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 3.35596507610211E-42
Duchenne muscular dystrophy 602 6.75994839812174E-11
pilocytic astrocytoma 3086 4.40808583955634E-10
posterior fossa group A ependymoma 1511 5.34139365934965E-9
non-small cell lung cancer 2798 7.18707326999047E-8
lung cancer 4473 3.04612039198103E-7
active Crohn's disease 918 5.86134541262381E-6
primary Sjogren syndrome 789 1.01955241411715E-4
limb girdle muscular dystrophy 2I 56 1.18825901934669E-4
active ulcerative colitis 477 1.47198972423444E-4
invasive ductal carcinoma 2950 2.4060872822251E-4
ovarian cancer 8492 3.27174654266596E-4
glioblastoma 5572 3.35439999633909E-4
interstitial cystitis 2299 3.79765130245586E-4
juvenile dermatomyositis 1189 4.9472848568806E-4
Becker muscular dystrophy 187 5.91218701545976E-4
Down syndrome 548 0.00162836882630715
breast carcinoma 1614 0.00166014923428155
adult high grade glioma 2148 0.0016901658623253
primary pancreatic ductal adenocarcinoma 1271 0.00324677586867144
diabetes mellitus 1663 0.00472356076660737
head and neck cancer and chronic obstructive pulmonary disease 237 0.0111761504554978
astrocytoma 1493 0.0114606029172328
esophageal adenocarcinoma 737 0.0179350527878244
adrenocortical carcinoma 1427 0.0326277496178954
Breast cancer 3099 0.0351581094864766
Waldenstrons macroglobulinemia 765 0.0363581637862939
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0401613972552524
subependymal giant cell astrocytoma 2287 0.0494604472086514
Disease Target Count Z-score Confidence
Ischemic fasciitis 1 4.101 2.1

Expression

Synonym

Accession P01903 A2BET4 Q30160 Q6IAZ1 Q861I2 Q9TP70
Symbols HLA-DRA1

Gene

PDB

2FSE   2SEB   4IS6   1BX2   1FV1   1HQR   1YMM   1ZGL   4Y19   4Y1A   1AQD   4OV5   3O6F   3T0E   4C56   1FYT   1J8H   2IAM   2IAN   2XN9   1A6A   2WBJ   1D5M   1D5X   1D5Z   1D6E   1DLH   1H15   1HXY   1JWM   1JWS   1JWU   1KG0   1KLG   1KLU   1LO5   1PYW   1R5I   1SEB   1SJE   1SJH   1T5W   1T5X   2G9H   2ICW   2IPK   2OJE   2Q6W   3C5J   3L6F   3PDO   3PGC   3PGD   3QXA   3QXD   3S4S   3S5L   4AEN   4AH2   4E41   4FQX   4GBX   4H1L   4H25   4H26   4I5B   4MCY   4MCZ   4MD0   4MD4   4MD5   4MDI   4MDJ   4X5W   4X5X  

  Ortholog (4)

Species Source
Chimp OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid

Gene RIF (150)

PMID Text
25998395 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection downregulates HLA-DR in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
25792471 The frequency of CD14(+)HLA-DR-/low MDSCs could be considered as a poor prognostic predictor in small-cell lung cancer (SCLC) and the elimination of MDSCs during medical interventions may improve the prognosis of SCLC patients.
25720714 No significant association was found for HLA-DRA/PARK18 rs3129882 polymorphism and Parkinson's disease risk (meta-analysis).
25695487 CD14+HLA-DR(-/low) cells were significantly increased in gastric cancer tissue and were shown to have a critical role in CD4+T-cell immunosuppression.
25319953 The results suggest that rs3129882 polymorphism in HLA-DR may be a risk factor for Parkinson's disease in Iranian.
25240755 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection downregulates HLA-DR in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
25224099 HLA-DRA variants predict penicillin allergy in genome-wide fine-mapping genotyping
25057007 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection downregulates HLA-DR in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
24904546 HIV-1 Nef cloned from subjects with early/acute progressive HIV infection downregulates HLA-DR in 721.221 cells to a greater extent relative to HIV-1 Nef cloned from subjects with chronic progressive infection
24849299 This meta-analysis showed that the HLA-DRA rs3129882 A/G polymorphism was not a risk factor for Parkinson's disease in Chinese.
More...

AA Sequence

MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRL      1 - 70
EEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPP     71 - 140
VVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSP    141 - 210
LPETTENVVCALGLTVGLVGIIIGTIFIIKGVRKSNAAERRGPL                              211 - 254
//

Text Mined References (71)

PMID Year Title
17241953 2007 Autophagy in MHC class II presentation: sampling from within.
16341674 2005 Transcriptome analysis of human gastric cancer.
16079912 2005 Structure of a human autoimmune TCR bound to a myelin basic protein self-peptide and a multiple sclerosis-associated MHC class II molecule.
15836703 2005 Association of fulminant non-A non-B hepatitis with homozygosity for HLA A1-B8-DR3.
15688398 2005 Tumor HLA-DR expression linked to early intrahepatic recurrence of hepatocellular carcinoma.
15536412 2004 Genetic basis of the latex-fruit syndrome: association with HLA class II alleles in a Spanish population.
15489916 2004 Function of the Src-family kinases, Lck and Fyn, in T-cell development and activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467430 2004 Anomalous expression of the HLA-DR alpha and beta chains in ovarian and other cancers.
15361126 2004 Microgeographic variation of HLA-A, -B, and -DR haplotype frequencies in Tuscany, Italy: implications for recruitment of bone marrow donors.
More...