Property Summary

NCBI Gene PubMed Count 27
PubMed Score 264.88
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Barrett's esophagus -1.300 3.7e-02
psoriasis -1.800 1.2e-05
cutaneous lupus erythematosus -2.600 1.1e-02
Atopic dermatitis -1.600 1.3e-03
lung cancer -3.600 3.0e-05
breast carcinoma 1.100 1.1e-03
lung carcinoma -1.900 6.2e-23

Gene RIF (46)

PMID Text
24904546 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22860026 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22407913 HLA-DQA2 and HLA-DQB2 genes are expressed in human Langerhans cells and encode a new HLA class II molecule.
22175768 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103834 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103833 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21922073 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21778700 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21257290 Data show that two peptides with naturally processed DQ8 (DQA1 *0301/DQB1 *0302) epitopes bound protective DR0403 with longer half-life and lower dissociation rate than susceptible DR0401, confirming DR0403 as a better peptide competitor than DR0401.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20012522 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
19851445 Observational study of gene-disease association. (HuGE Navigator)
19770068 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
19620308 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
19449444 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
19180512 Observational study of gene-disease association. (HuGE Navigator)
19149577 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
18945465 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
17959659 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
16454711 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
16354571 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
16091223 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
15194762 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
15078178 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
14730600 Observational study of gene-disease association. (HuGE Navigator)
12970439 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
12836198 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
12427289 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
11593029 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
11118314 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
10729169 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
10661406 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
9079699 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
8376762 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
8168144 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
8084338 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
7602119 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
7541827 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
7512597 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
3489470 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
2846691 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
2543930 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
1978941 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
1967269 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
1869305 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells

AA Sequence

MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVARYIYNREEYG      1 - 70
RFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEAL     71 - 140
NHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTSLIRNGDWTFQILVMLEITPQRGDIYTCQVEHPS    141 - 210
LQSPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIRHRGQKGPRGPPPAGLLH                211 - 268
//

Text Mined References (35)

PMID Year Title
24940741 2014 A genome-wide association study on chronic HBV infection and its clinical progression in male Han-Taiwanese.
24162738 2013 New loci associated with chronic hepatitis B virus infection in Han Chinese.
23760081 2013 A genome-wide association study identified new variants associated with the risk of chronic hepatitis B.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23349640 2013 Susceptibility loci associated with specific and shared subtypes of lymphoid malignancies.
23053960 2012 Genome-wide pathway analysis of genome-wide association studies on systemic lupus erythematosus and rheumatoid arthritis.
22446962 2012 A genome-wide association study identifies three new risk loci for Kawasaki disease.
22407913 2012 HLA-DQA2 and HLA-DQB2 genes are specifically expressed in human Langerhans cells and encode a new HLA class II molecule.
21750111 2011 A genome-wide association study of chronic hepatitis B identified novel risk locus in a Japanese population.
21408207 2011 Differential genetic associations for systemic lupus erythematosus based on anti-dsDNA autoantibody production.
21257290 2011 Differences in self-peptide binding between T1D-related susceptible and protective DR4 subtypes.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19533806 2009 CD74 in antigen presentation, inflammation, and cancers of the gastrointestinal tract.
19180512 2009 HLA-E gene polymorphism associated with susceptibility to Kawasaki disease and formation of coronary artery aneurysms.
19092054 2009 MHC class II transport at a glance.
18046453 2008 MHC class II molecules on the move for successful antigen presentation.
17241953 2007 Autophagy in MHC class II presentation: sampling from within.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14730600 2004 Analysis of single-nucleotide polymorphisms in Japanese rheumatoid arthritis patients shows additional susceptibility markers besides the classic shared epitope susceptibility sequences.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11684289 2001 Presentation of antigens by MHC class II molecules: getting the most out of them.
11334674 2001 Absence of in vivo DNA-protein interactions in the DQA2 and DQB2 promoter regions.
11118314 2000 Reciprocal modulation of transcriptional activities between HIV-1 Tat and MHC class II transactivator CIITA.
10661406 2000 Tat competes with CIITA for the binding to P-TEFb and blocks the expression of MHC class II genes in HIV infection.
9036956 1997 The nonpolymorphic MHC class II isotype, HLA-DQA2, is expressed on the surface of B lymphoblastoid cells.
8598037 1996 Invariant chain structure and MHC class II function.
8568858 1996 Evolutionary dynamics of non-coding sequences within the class II region of the human MHC.
3858830 1985 Gene organization of DC and DX subregions of the human major histocompatibility complex.
3036828 1987 Class II genes of the human major histocompatibility complex. Comparisons of the DQ and DX alpha and beta genes.
2564844 1989 Remarkable sequence conservation of the HLA-DQB2 locus (DX beta) within the highly polymorphic DQ subregion of the human MHC.
1420115 1992 Nucleotide sequencing of HLA-DQ gene second exons in Chinese homozygous cells.