Property Summary

NCBI Gene PubMed Count 1,388
PubMed Score 564.49
PubTator Score 486.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Juvenile rheumatoid arthritis 111 0.0 5.0
Type 1 diabetes mellitus 109 0.0 5.0

Expression

  Differential Expression (35)

Disease log2 FC p
active Crohn's disease 5.681 7.7e-04
active ulcerative colitis 3.980 3.3e-04
astrocytoma 1.100 7.3e-04
Astrocytoma, Pilocytic 1.500 2.4e-03
atypical teratoid/rhabdoid tumor -1.400 1.5e-03
breast carcinoma 1.500 8.8e-03
colon cancer -1.700 2.8e-02
cystic fibrosis -1.700 1.1e-04
Duchenne muscular dystrophy 1.650 1.7e-08
ductal carcinoma in situ 1.300 2.6e-02
esophageal adenocarcinoma 1.200 1.9e-02
glioblastoma 1.800 2.9e-02
group 4 medulloblastoma -1.400 1.3e-02
interstitial cystitis 1.800 1.5e-03
intraductal papillary-mucinous adenoma (... -1.600 1.9e-02
intraductal papillary-mucinous carcinoma... -1.900 1.7e-02
intraductal papillary-mucinous neoplasm ... -1.800 2.0e-02
invasive ductal carcinoma 1.738 1.1e-03
juvenile dermatomyositis 1.106 8.4e-05
limb girdle muscular dystrophy 2I 1.324 1.3e-03
lung cancer -2.900 4.7e-05
lung carcinoma -3.300 6.0e-11
medulloblastoma, large-cell -1.500 2.7e-03
nephrosclerosis 1.077 3.8e-03
non-small cell lung cancer -1.329 1.3e-08
ovarian cancer 2.800 6.4e-06
pancreatic cancer -1.100 1.1e-03
pancreatic carcinoma -1.100 1.1e-03
pancreatic ductal adenocarcinoma liver m... 1.411 2.2e-02
pituitary cancer -1.200 3.8e-02
primary Sjogren syndrome 3.100 4.5e-04
subependymal giant cell astrocytoma 2.748 1.9e-02
tuberculosis 3.800 1.4e-02
type I diabetes mellitus -3.918 2.2e-02
Waldenstrons macroglobulinemia 1.966 4.7e-02

Gene

PDB

1UVQ   1JK8   4GG6   4OZF   4OZG   4OZH   4OZI   1NBN   1S9V   2NNA  

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Protein-protein Interaction (10)

Gene RIF (1479)

AA Sequence

MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYA      1 - 70
RFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEA     71 - 140
LNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHP    141 - 210
SLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH                       211 - 261
//

Text Mined References (1413)

PMID Year Title