Property Summary

NCBI Gene PubMed Count 731
PubMed Score 886.75
PubTator Score 1145.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (15)

Disease log2 FC p
Systemic lupus erythematosus -1.800 3.2e-02
active Crohn's disease 4.148 8.3e-03
adult high grade glioma 2.300 1.0e-02
Chronic obstructive pulmonary disease -1.800 2.2e-02
Duchenne muscular dystrophy 1.100 5.6e-04
glioblastoma 3.100 6.7e-03
invasive ductal carcinoma 4.000 1.4e-02
lung cancer -3.100 7.9e-07
lung carcinoma -2.600 3.3e-10
non-small cell lung cancer -1.798 7.1e-05
ovarian cancer 1.100 4.5e-02
primary Sjogren syndrome 3.300 1.1e-04
tuberculosis 4.100 2.3e-02
type I diabetes mellitus -4.048 2.5e-02
ulcerative colitis 2.300 4.3e-02

 CSPA Cell Line (3)

PDB (14)

Gene RIF (745)

AA Sequence

MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWC      1 - 70
LPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPP     71 - 140
VVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAP    141 - 210
MSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL                              211 - 254
//

Text Mined References (740)

PMID Year Title