Property Summary

NCBI Gene PubMed Count 32
PubMed Score 344.88
PubTator Score 43.63

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (50)

PMID Text
25874709 TAP2, HLA-DOA, HLA-DOB, and tapasin loci are novel candidate regions for susceptibility to HCV infection and viral clearance in the Chinese population
24904546 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
24162774 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
23400868 HLA-DO beta-chain antigens are ubiquitinated by MARCH family E3 ligases 1, 8, and 9.
23222639 results show that HLA-DO inhibits HLA-DM function by acting as a substrate mimic, and the findings also limit the possible functional roles for HLA-DO in antigen presentation
22860026 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22175768 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103834 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103833 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21922073 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21778700 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20012522 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
19851445 Observational study of gene-disease association. (HuGE Navigator)
19770068 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
19620308 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
19449444 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
19149577 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
18945465 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
17959659 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
16454711 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
16354571 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
16091223 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
15847654 Observational study of genetic testing. (HuGE Navigator)
15730525 A new DOB allele, DOB*010103, was identified in the Korean population during sequence-based HLA-DOB typing.
15265882 In transgenic mice expressing human HLA-DOA & HLA-DOB from a DC-specific promoter, as DO increased, A(b)-CLIP increased & class II-peptides decreased. DO impaired H-2M function, causing Ag-specific downmodulation of class II Ag processing/presentation.
15194762 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
15078178 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
12970439 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
12836198 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
12439622 HLA-DOB mutations were analyzed for association with autoimmune diseases and B-cell leukemias.
12427289 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
11593029 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
11118314 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
10729169 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
10661406 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
9079699 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
8376762 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
8168144 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
8084338 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
7602119 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
7541827 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
7512597 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
3489470 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
2846691 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
2543930 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
1978941 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
1967269 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
1869305 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells

AA Sequence

MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDV      1 - 70
GMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNL     71 - 140
LHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPV    141 - 210
SVEWRAQSEYSWRKMLSGIAAFLLGLIFLLVGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC           211 - 273
//

Text Mined References (34)

PMID Year Title
25874709 2015 Association of polymorphisms in HLA antigen presentation-related genes with the outcomes of HCV infection.
23400868 2013 Ubiquitination of HLA-DO by MARCH family E3 ligases.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23222639 2013 HLA-DO acts as a substrate mimic to inhibit HLA-DM by a competitive mechanism.
22733780 2012 Mapping the HLA-DO/HLA-DM complex by FRET and mutagenesis.
22446962 2012 A genome-wide association study identifies three new risk loci for Kawasaki disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
17652306 2007 Keeping the (kinase) party going: SLP-76 and ITK dance to the beat.
15847654 2005 A flexible array format for large-scale, rapid blood group DNA typing.
15730525 2005 Identification of a novel HLA-DOB-allele, DOB*010103, by sequence-based typing in the Korean population.
15489916 2004 Function of the Src-family kinases, Lck and Fyn, in T-cell development and activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15265882 2004 Ectopic expression of HLA-DO in mouse dendritic cells diminishes MHC class II antigen presentation.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445321 2002 The HLA-DOB gene displays limited polymorphism with only one amino acid substitution.
12439622 2002 Novel polymorphisms in HLA-DOA and HLA-DOB in B-cell malignancies.
11827988 2002 Adapters in lymphocyte signaling.
11823510 2002 Class II transactivator is required for maximal expression of HLA-DOB in B cells.
11118314 2000 Reciprocal modulation of transcriptional activities between HIV-1 Tat and MHC class II transactivator CIITA.
11048639 2000 The mechanism of phospholipase C-gamma1 regulation.
10837054 2000 Nonclassical MHC class II molecules.
10661406 2000 Tat competes with CIITA for the binding to P-TEFb and blocks the expression of MHC class II genes in HIV infection.
9311912 1997 Negative regulation by HLA-DO of MHC class II-restricted antigen processing.
9088974 1997 HLA-DO is an intracellular class II molecule with distinctive thymic expression.
8890155 1996 HLA-DO is a lysosomal resident which requires association with HLA-DM for efficient intracellular transport.
8568858 1996 Evolutionary dynamics of non-coding sequences within the class II region of the human MHC.
8458375 1993 The major histocompatibility complex-encoded proteasome component LMP7: alternative first exons and post-translational processing.
3036827 1987 Class II genes of the human major histocompatibility complex. The DO beta gene is a divergent member of the class II beta gene family.
2998758 1985 DO beta: a new beta chain gene in HLA-D with a distinct regulation of expression.
2499532 1989 Human class II DNA and DOB genes display low sequence variability.
1453454 1992 DNA sequence analysis of 66 kb of the human MHC class II region encoding a cluster of genes for antigen processing.