Property Summary

NCBI Gene PubMed Count 44
PubMed Score 73.09
PubTator Score 61.87

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (61)

AA Sequence

MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWR      1 - 70
LPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPKSRVELGQPNILICIVDNIFP     71 - 140
PVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKFHYLPFVPSAEDVYDCQVEHWGLDAPLLRHWELQVPI    141 - 210
PPPDAMETLVCALGLAIGLVGFLVGTVLIIMGTYVSSVPR                                  211 - 250
//

Text Mined References (46)

PMID Year Title