Property Summary

NCBI Gene PubMed Count 72
PubMed Score 0.00
PubTator Score 117.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
nephrosclerosis 1.027 5.5e-04
Waldenstrons macroglobulinemia 1.695 6.1e-03
malignant mesothelioma -1.900 2.6e-06
esophageal adenocarcinoma 2.200 1.8e-02
astrocytoma 3.300 9.6e-03
glioblastoma 3.800 2.4e-04
osteosarcoma -1.402 2.0e-02
posterior fossa group A ependymoma 2.200 1.3e-07
Duchenne muscular dystrophy 1.775 1.7e-09
limb girdle muscular dystrophy 2I 1.293 8.2e-04
juvenile dermatomyositis 1.309 4.7e-07
adrenocortical carcinoma -1.765 1.2e-02
tuberculosis and treatment for 3 months 1.100 3.9e-06
pancreatic ductal adenocarcinoma liver m... 2.235 2.7e-02
non-small cell lung cancer -1.632 1.5e-11
colon cancer -1.800 2.1e-02
lung cancer -3.900 2.5e-06
active Crohn's disease 4.340 3.2e-05
active ulcerative colitis 3.578 3.0e-04
diabetes mellitus -1.400 3.3e-03
interstitial cystitis 2.000 3.2e-04
adult high grade glioma 2.100 3.7e-03
pilocytic astrocytoma 2.700 5.0e-09
subependymal giant cell astrocytoma 3.304 3.7e-03
invasive ductal carcinoma 1.489 1.2e-03
lung carcinoma -3.000 1.6e-38
ovarian cancer 2.300 1.1e-06
Down syndrome 1.100 1.0e-02
head and neck cancer and chronic obstruc... 1.300 3.0e-03

Gene RIF (67)

PMID Text
26610428 pH-susceptibility of HLA-DO tunes DO/DM ratios to regulate HLA-DM catalytic activity.
25505276 study therefore reveals that HLA-DM polymorphic residues have a considerable impact on HLA-DM catalytic activity.
24904546 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
23260142 The structure of the HLA-DM-HLA-DR complex shows major rearrangements of the HLA-DR peptide-binding groove.
22860026 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22309257 DMA*01:01 (69.35%) and DMB*01:01 (52.5%) alleles were more frequent in Chinese Hans
22175768 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103834 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
22103833 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21922073 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
21778700 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20408893 Multiple mechanisms, operating along the biosynthetic pathway of class II molecules, contribute to DM-mediated increases in the abundance of low-CLIP-affinity alleles.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20012522 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19770068 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
19620308 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
19449444 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
19149577 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
19115949 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18945465 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
18779172 Observational study of genotype prevalence. (HuGE Navigator)
18348411 Observational study of gene-disease association. (HuGE Navigator)
17959659 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
17015729 glycosylation promotes, but is not essential for, DMalphabeta ER exit; single DMalpha chains cannot fully oxidize without DMbeta, while DMbeta forms disulfide-linked homodimers without DMalpha
16864101 Observational study of gene-disease association. (HuGE Navigator)
16737583 Observational study of gene-disease association. (HuGE Navigator)
16454711 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
16354571 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
16091223 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
15723810 The absence of HLA-DR/DM interactions at the limiting membrane prevents local loading of MHC class II molecules in phagosomes
15547089 Observational study of gene-disease association. (HuGE Navigator)
15547082 Observational study of gene-disease association. (HuGE Navigator)
15194762 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
15078178 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
14754527 HLA-DMA may play an important role in pathogenesis of type 1 diabetes, and clinical status heterogeneity of type 1 diabetes may be related to genetic mechanism.
12970439 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
12858445 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12858445 The results suggest that HLA-DMA*0104 may represent a novel allele of susceptibility to systemic lupus erythematosus.
12836198 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
12794545 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12786997 Observational study of gene-disease association. (HuGE Navigator)
12648225 Observational study of gene-disease association. (HuGE Navigator)
12427289 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
11881821 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11881821 HLA DMA and DMB show no association with rheumatoid arthritis in US Caucasians.
11775239 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11593029 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
11180452 Observational study of gene-disease association. (HuGE Navigator)
11118314 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
10729169 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
10661406 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
9079699 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
8376762 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
8168144 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
8084338 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
7602119 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
7541827 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
7512597 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
3489470 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
2846691 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
2543930 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
1978941 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
1967269 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells
1869305 Expression of patient-derived HIV-1 nef alleles downregulates MHC-II cell surface expression in activated CD4+ T cells

AA Sequence

MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFF      1 - 70
FDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFG     71 - 140
KPNTLVCFVSNLFPPMLTVNWHDHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDR    141 - 210
YTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD                       211 - 261
//

Text Mined References (74)

PMID Year Title
26610428 2015 pH-susceptibility of HLA-DO tunes DO/DM ratios to regulate HLA-DM catalytic activity.
25505276 2015 HLA-DMA polymorphisms differentially affect MHC class II peptide loading.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23260142 2012 Crystal structure of the HLA-DM-HLA-DR1 complex defines mechanisms for rapid peptide selection.
22733780 2012 Mapping the HLA-DO/HLA-DM complex by FRET and mutagenesis.
22309257 2012 Analysis of HLA-DM polymorphisms in the Chinese Han population.
22247549 2012 Ubiquitination of human leukocyte antigen (HLA)-DM by different membrane-associated RING-CH (MARCH) protein family E3 ligases targets different endocytic pathways.
21131964 2011 HLA-DM captures partially empty HLA-DR molecules for catalyzed removal of peptide.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20408893 2010 DM influences the abundance of major histocompatibility complex class II alleles with low affinity for class II-associated invariant chain peptides via multiple mechanisms.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19115949 2009 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).
18779172 2008 [HLA-DM polymorphisms in Guizhou Han individuals].
18348411 2007 HLA-DM polymorphism and risk of trichloroethylene induced medicamentosa-like dermatitis.
17652306 2007 Keeping the (kinase) party going: SLP-76 and ITK dance to the beat.
17015729 2006 The DMalpha and DMbeta chain cooperate in the oxidation and folding of HLA-DM.
16864101 2006 [HLA-DM gene polymorphism in Cantonese with condyloma acuminata].
16737583 2006 [Relationship of trichloroethylene-induced medicamentosa like dermatitis to HLA-DMA and HLA-DMB].
16547258 2006 Small molecules that enhance the catalytic efficiency of HLA-DM.
16435885 2006 Reconstructing an ancestral mammalian immune supercomplex from a marsupial major histocompatibility complex.
15723810 2005 Spatial separation of HLA-DM/HLA-DR interactions within MIIC and phagosome-induced immune escape.
15547089 2004 Association of HLA-DM polymorphism with the production of antiphospholipid antibodies.
15547082 2004 HLA-DMA*0103 and HLA-DMB*0104 alleles as novel prognostic factors in rheumatoid arthritis.
15489916 2004 Function of the Src-family kinases, Lck and Fyn, in T-cell development and activation.
14754527 2003 [Association of human leukocyte antigen non-classical genes with type 1 diabetes].
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12928384 2003 Regulation of the class II MHC pathway in primary human monocytes by granulocyte-macrophage colony-stimulating factor.
12858445 2003 Polymorphism of HLA-DMA and DMB alleles in patients with systemic lupus erythematosus.
12794545 2003 The complexity of HLA class II (DRB1, DQB1, DM) associations with disseminated Mycobacterium avium complex infection among HIV-1-seropositive whites.
12786997 2003 Lack of association between transporter associated with antigen processing (TAP) and HLA-DM gene polymorphisms and antibody levels following measles vaccination.
12742663 2003 Antigen processing and presentation in human muscle: cathepsin S is critical for MHC class II expression and upregulated in inflammatory myopathies.
12728471 2003 Increased expression of intracellular HLA-DM but not on the surface of blood monocyte-derived dendritic cells during maturation.
12663675 2003 Human germinal center B cells differ from naive and memory B cells by their aggregated MHC class II-rich compartments lacking HLA-DO.
12648225 2003 Association of TAP and HLA-DM genes with psoriasis in Koreans.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12392850 2002 Human duodenal epithelial cells constitutively express molecular components of antigen presentation but not costimulatory molecules.
11956296 2002 Regulated expression of human histocompatibility leukocyte antigen (HLA)-DO during antigen-dependent and antigen-independent phases of B cell development.
11881821 2001 HLA DMA and DMB show no association with rheumatoid arthritis in US Caucasians.
11827988 2002 Adapters in lymphocyte signaling.
11775239 2000 Polymorphisms of TAP, LMP and HLA-DM genes in the Chinese.
11743588 2002 Tetraspan microdomains distinct from lipid rafts enrich select peptide-MHC class II complexes.
11739502 2001 In vivo and in vitro modulation of HLA-DM and HLA-DO is induced by B lymphocyte activation.
11441095 2001 Regulation of MHC class II antigen presentation by sorting of recycling HLA-DM/DO and class II within the multivesicular body.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
11180452 2001 Association between the ancestral haplotype HLA A30B18DR3 and multiple sclerosis in central Sardinia.
11168931 2001 Unusual expression of human lymphocyte antigen class II in normal renal microvascular endothelium.
11118314 2000 Reciprocal modulation of transcriptional activities between HIV-1 Tat and MHC class II transactivator CIITA.
11070170 2000 Determination of the HLA-DM interaction site on HLA-DR molecules.
11048639 2000 The mechanism of phospholipase C-gamma1 regulation.
10716924 2000 Functional HLA-DM on the surface of B cells and immature dendritic cells.
10661406 2000 Tat competes with CIITA for the binding to P-TEFb and blocks the expression of MHC class II genes in HIV infection.
10631952 1999 The impact of the non-classical MHC proteins HLA-DM and HLA-DO on loading of MHC class II molecules.
10322421 1999 HLA-DM - an endosomal and lysosomal chaperone for the immune system.
9879837 1998 HLA-DM is expressed on the cell surface and colocalizes with HLA-DR and invariant chain in human Langerhans cells.
9768757 1998 The structure of HLA-DM, the peptide exchange catalyst that loads antigen onto class II MHC molecules during antigen presentation.
9759843 1998 The tetraspan protein CD82 is a resident of MHC class II compartments where it associates with HLA-DR, -DM, and -DO molecules.
9551909 1998 Aberrant intermolecular disulfide bonding in a mutant HLA-DM molecule: implications for assembly, maturation, and function.
9371817 1997 Interaction between HLA-DM and HLA-DR involves regions that undergo conformational changes at lysosomal pH.
9311912 1997 Negative regulation by HLA-DO of MHC class II-restricted antigen processing.
8947036 1996 Editing of the HLA-DR-peptide repertoire by HLA-DM.
8890155 1996 HLA-DO is a lysosomal resident which requires association with HLA-DM for efficient intracellular transport.
8849454 1996 Enhanced dissociation of HLA-DR-bound peptides in the presence of HLA-DM.
8574855 1996 Association between HLA-DM and HLA-DR in vivo.
8568858 1996 Evolutionary dynamics of non-coding sequences within the class II region of the human MHC.
8225438 1994 Limited polymorphism in HLA-DM does not involve the peptide binding groove.
8139690 1994 HLA-DMA and -DMB genes are both required for MHC class II/peptide complex formation in antigen-presenting cells.
8034636 1994 Genomic organization of HLA-DMA and HLA-DMB. Comparison of the gene organization of all six class II families in the human major histocompatibility complex.
8026867 1994 Sequence analysis of two novel HLA-DMA alleles.
7606781 1995 HLA-DM induces CLIP dissociation from MHC class II alpha beta dimers and facilitates peptide loading.
1922385 1991 Second proteasome-related gene in the human MHC class II region.
1922365 1991 A new human HLA class II-related locus, DM.