Property Summary

NCBI Gene PubMed Count 1,181
PubMed Score 4042.73
PubTator Score 2865.77

Knowledge Summary

Patent

No data available

Gene RIF (1205)

PMID Text
26974162 Promiscuous Recognition of a Trypanosoma cruzi CD8+ T Cell Epitope among HLA-A2, HLA-A24 and HLA-A1 Supertypes in Chagasic Patients.
26967484 HLA-A alleles are associated with dermatitis herpetiformis in Chinese population.
26787886 Vitiligo risk associated with the MHC class I region thus derives from combined quantitative and qualitative phenomena: a SNP haplotype in a transcriptional regulator that induces gain-of-function, elevating expression of HLA-A RNA
26656886 the carriage of HLA-A SNP rs1655900 studied is not associated with the susceptibility to CT infection based on the data from the STD cohort.
26621839 Data indicate that adoptive transfer of peptide-induced cytotoxic T lymphocytes (CTL) cells from HLA-A2 transgenic mice into human tumor xenograft SCID mice significantly inhibited tumor growth.
26600404 This report presents results of a study of similarities and dissimilarities comparing all possible pairs of 43 high resolution X-ray structures of human HLA-A2.
26564811 expression on melanoma variants with B-Raf kinase inhibitors plays a major role in their susceptibility to NK-cell cytotoxicity
26507656 mutant N-terminally extended peptides exhibited significantly increased HLA-A*02:01 binding affinity and elicited CD8(+) T cell stimulation in vitro similar to the wtgp100209-217 epitope.
26490229 HLA-A*31:01 was confirmed to be significantly associated with definite/probable cases of Stevens-Johnson syndrome/toxic epidermal necrolysis
26448174 HLA-A*02:06 with Toll Like Receptor 3 polymorphisms and HLA-A*02:06 with prostaglandin e receptor-3 polymorphisms exerted additive effects in Stevens-Johnson Syndrome with Surface Ocular Complications
26439863 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
26422112 Results demonstrate that HLA-A*02 mediates a modest, but none the less stronger, EBV-specific CD8(+) T cell response than non-HLA-A*02 alleles.
26375851 antigen presentation for a broad panel of HLA molecules
26345971 HLA-A* 02:07 is likely an important genetic risk factor for postmenopausal osteoporosis in the Han Chinese population.
26331842 The study investigates the link between Behcet's Disease and two specific HLA alleles associated with Behcet's Disease (HLA-A*26:01 and HLA-B*51:01) in terms of their binding affinity to the MICA.
26310460 Report decreased costimulatory B7 family protein expression in HLA-A2 transgenic mice with chronic kidney disease/uremia.
26258424 Cell surface expression level variation between two common human leukocyte antigen alleles, HLA-A2 and HLA-B8, is dependent on the structure of the C terminal part of the alpha 2 and the alpha 3 domains.
26199258 The HLA-DRB1*15 allele, the A*01/B*08/DRB1*03 haplotypes, and the homozygosity of HLA-A*01 and HLA-A*02 may play a presumptive predisposing factor in Acute Myeloblastic Leukemia.
26083016 Sensitivity and specificity were considered the primary end points and were 100% across the four populations for rs2395029-HLA-B*57:01. SNP prediction of HLA-A*31:01 had 100% sensitivity and 84% specificity
26061722 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
26057149 HLA Class I (HLA- A, -B, -C) antigens are downregulated by LMP2A protein in Epstein-Barr virus-infected gastric cancer cells.
26037364 Three novel HLA-A alleles were confirmed,HLA-A*24:224, HLA-A*24:225 and HLA-A*24:257, in Chinese Han individuals.
25972545 RSV infection of lung epithelial cells induces expression of RIG-I, NLRC5, and subsequent upregulation of HLA-A, HLA-B and HLA-C.
25940993 In nasopharyngeal carcinoma, a stronger protective effect was observed in homozygotes for HLA-A*11:01 compared with heterozygotes for HLA-A*11:01.
25940109 we were not able to formally replicate the association with IL10 and IL23R-IL12RB2, we do report that BD in Iran is strongly associated with HLA-B*51, MICA-A6, and the three HLA-linked SNPs
25935001 These data demonstrate HLA-A allelic lineage-specific variation in expression levels, and DNA methylation as a likely factor in contributing to this variation.
25915798 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25827531 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25809376 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25781986 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25754738 relative expression levels of HLA-A, HLA-B, HLA-C, and HLA-E proteins for the specific haplotype A*02:01, B*44:02, C*05:01, which were characterized using two independent methods based on flow cytometry and mass spectrometry.
25701112 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25666956 Our results demonstrated the association of HLA-C*03 and HLA-DRB1*01 alleles with Macedonian autistic patients
25666200 The HLA-A*02-positive patients had a higher rapid virological response and and a lower relapse rate than the control.
25659158 These findings support a previous study that this allele may confer protection against the severe form of dengue and provide the first evidence of HLA association with dengue in the Philippines.
25645285 The results demonstrate that vitiligo is specifically associated with HLA-A*02:01 in Japanese.
25626601 The study aims to assess the distribution of HLA-A, -B, -Cw and DRB1 alleles in Moroccan patients with ankylosing spondylitis (AS) and to compare the clinical features of AS and the frequencies of HLA-B27 in patients from Morocco.
25620704 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25617474 HLA-A02:01-restricted epitopes identified from the herpes simplex virus protein VP11/12 preferentially recall effector memory CD8+ T cells from seropositive asymptomatic individuals and protect humanized HLA-A*02:01 transgenic mice against ocular herpes.
25589651 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25585010 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25549594 may present as a genetic susceptibility factors in Iranian patients with Non-Hodgkin's lymphoma
25525794 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25515742 HLA-A*80:01:01:01 allele clusters with gorilla and chimpanzee major histocompatibility complex sequences, suggesting an origin coming from a common ancestor to gorilla and chimpanzee.
25495410 Our data suggest the HLA-A*02:01:01/-B*35:01:01/-C*04:01:01 haplotype may be a biomarker for LTG-induced maculopapular exanthema and the HLA-C*08:01 allele for PHT-induced MPE.
25469587 HLA polymorphism influence susceptibility to chronic hepatitis B infection.
25423108 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25413106 Among 17 alleles so far observed only once in our population, 6 (A*24:41, B*07:02:28, B*35:03:03, B*39:40N, DRB1*13:23 and DRB1*14:111) belong to very rare alleles, 2 (B*44:16 and DRB1*01:31) belong to rare alleles
25355886 This work shows that the alleles HLA-A*33 and HLA-B*44 are significantly enriched in postherpetic neuralgia patients, while HLA-A*02 and HLA-B*40 are significantly depleted.
25352173 The frequency of A*68:23 in this Chilean population is >0.0125. This HLA-A allele appears to fit the description of a well-documented allele in this population studied in Santiago, Chile.
25330014 Individuals who carried both KIR3DS1 and Bw4*80I did not remain HIV seronegative longer than those from a control group who were homozygous for HLA-Bw6 and carried no HLA-A locus Bw4 alleles
25324153 An interaction was observed between passive smoking and absence of HLA-A*02 in development of multiple sclerosis. Priming of the immune response in the lungs may subsequently lead to MS in people with a genetic susceptibility to the disease.
25295286 Data indicate that positivity for class I histocompatibility antigens HLA-A and HLA-B types did not differ significantly in Common variable immunodeficiency (CVID) and immunoglobulin (Ig) G subclass deficiency (IgGSD) patients.
25279819 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25275127 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25244652 prevalence of newer alleles: HLA-A*24:23, A*30:10, DRB1*08:11, DRB1*15:03, and DRB1*15:06.
25243920 Human herpesvirus 6B immediate-early I protein contains functional HLA-A*02, HLA-A*03, and HLA-B*07 class I restricted CD8(+) T-cell epitopes.
25197660 The potential roles in Alzheimer's disease pathogenesis of endothelial regulation, infectious diseases, specific antigen presentation, and HLA-A2 in maintaining synapses, are reported.
25193656 The effects of HIV Nef protein on down regulation of CD4 and HLA class I in patients with early and chronic HIV infection with HIV-1 subtype C is reported.
25193656 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25187890 Antiepileptic drugs-induced skin rash can occur independently HLA-A*3101 genotypes in the Korean patients.
25165114 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
25099678 Trans-ethnic study confirmed independent associations of HLA-A*02:06 and HLA-B*44:03 with cold medicine-related Stevens-Johnson syndrome with severe ocular surface complications.
24990997 Influenza A virus M158-66 elicited cytotoxic T lymphocyte responses in both HLA-A*02- and HLA-C*08-positive individuals.
24965469 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
24963477 results demonstrated that the HLA-A*68, HLA-B*51, and HLA-DRB1*15 alleles were significantly more frequent in HD patients in comparison to controls
24947555 report the strong genetic influence of HLA-A on nasopharyngeal carcinoma susceptibility in the Malaysian Chinese
24942586 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
24904546 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
24886641 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
24789790 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
24781922 We propose that HLA-A*02:06 and HLA-B*44:03 be considered as strong risk factors for CM-SJS/TEN with SOC.
24748005 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
24737799 Immunocompetent subjects carrying the homozygous A haplotype or the HLABw4(T) allele are at higher risk of developing symptomatic disease after primary cytomegalovirus infection.
24717292 Donor mismatches at HLA-A loci contributed to the development of HLA-specific antibodies in patients listed for repeat renal transplantation.
24691290 HLA-A, -B and -DRB1 allele frequencies and their haplotype frequencies in 21,918 Chinese residents living in Liaoning Provinc, were investigated.
24681846 Antigen-specific and HLA-A*0201-restricted interferon-gamma release.
24662416 HLA-A*02 allele multiple sclerosis carriers have reduced IgG antibody response against human herpesvirus 6.
24597466 In this review, risk for carbamazepine-induced hypersensitivity is linked to HLA-A*31:01 and is common in most ethnic groups.
24554773 Results indicate the role of HLA class I molecules HLA-A, HLA-B and HLA-C in NK cell maturation and KIR repertoire acquisition.
24553509 HLA-A*31 expression is associated to risk of developing sepsis.
24550293 Activating killer cell immunoglobulin-like receptor 2DS2 binds to HLA-A*11.
24500647 There is a significant interaction between absence of HLA-A*02 and obesity regardless of HLA-DRB1*15 status, in relation to the risk of developing multiple sclerosis.
24495362 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
24490781 The HLA-A*32, HLA-DQB1*05 and HLA-DRB1*01 allele frequencies may be associated with the development of seborrhoeic dermatitis.
24476427 HLA-A*31:01 is associated with carbamazepine hypersensitivity in Caucasian and Japanese populations.
24400003 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
24389314 genetic polymorphism is associated with nasopharyngeal carcinoma among a Han population in Northwestern China
24375541 Two novel human leukocyte antigen-A*0201-restricted, cytotoxic T lymphocyte epitopes on CD133 have been identified for cancer stem cell immunotherapy.
24336023 Results show the presence of HLA alleles contributing toward risk of as well as protection against various carbamazepine-induced cutaneous adverse drug reactions.
24324503 The frequency of HLA-A *33:03:01G was increased in persistent HBV infection group, while frequency of HLA-B *13:01:01G was increased in HBsAg clearance group
24269699 allele frequency is associated with progressive and non-progressive chronic lymphocytic leukemia in Iranian patients
24248811 MHC class I and II polymorphic Alu insertions and HLA-A, -B, -C and -DRB1 alleles in the Chinese Han population are associated with crossing over events within the same and/or different populations.
24244023 In gastric & esophaeal cancer cell lines, MAPK pathway inhibition upregulated HLA-A02 & HLA-A24 expression. HLA-A expression was predominantly regulated by the MAPK pathway, but it was also influenced by the Akt pathway.
24223798 HLA-A*0201-restricted T cell epitopes derived from the EGFR T790M mutation have been identified and can be used for immunotherapy to reverse the EGFR T790M-mediated drug resistance.
24192765 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
24172637 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
24158818 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
24084328 High HLA-A2 expression is associated with lower risk of BK viremia.
24058696 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
24046013 Data indicate the association of HLA-A, -B, -C, and -DRB1 incompatibilities with adverse outcome in hematopoietic stem cell transplantation (HSCT).
24041011 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
24033735 HLA-A*68 allele associated with retinopathy of prematurity
24023945 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
23994122 3 locus haplotype analysis of HLA-A, B and DR revealed significantly increased frequency of A( *)24-B( *)40-DRB1( *)15 haplotype among patients with pulmonary tuberculosis than controls, while A( *)02-B( *)40-DRB1( *)16 and A( *)02-B40-DRB1( *)03 were significantly reduced in the patients
23986795 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
23963968 HLA-A2-restricted CD4(+) T cells were seldom expanded in immune HLA-A2(+) donors, suggesting that they are not usually engaged in in vivo immune responses against the corresponding peptide-MHC class I complexes.
23953521 Report HLA-A allele and haplotype frequency in Turkish chronic kidney disease patients undergoing renal dialysis.
23911395 Data suggest that HLA-A*24:02-restricted Ad11 epitope could be used for anti-Ad11 adoptive immunotherapy.
23874603 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
23853598 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
23847689 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
23836912 the flexibility of the peptide binding groove of the class I MHC protein HLA-A*0201 varies significantly with different peptides.
23724919 Data indicate that 44 HLA-A, 67 HLA-B and 48 HLA-DRB1 most probable alleles were identified.
23678182 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
23638805 The most frequent haplotypes that may be associated with susceptibility to American cutaneous leishmaniasis were A*02 B*44 DRB1*07 (P = 0.0236) and A*24 B*35 DRB1*01 (P = 0.0236).
23588310 HLA-A 31:01 ..... as genetic markers for carbamazepine hypersensitivity in children.
23566939 The overall structure and peptide conformation of HLA-A*6802 are more similar to HLA-A*6801 rather than HLA-A*0201 which illuminates the similar serotype grouping of HLA-A*6802 and HLA-A*6801
23490051 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
23349864 different HLA loci(HLA-A and HLA-B) are differentially regulated during differentiation of stem cells
23330836 Association of human leukocyte antigen class I antigens in Iranian patients with pemphigus vulgaris.
23289738 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
23246585 Data indicate that full length genomic sequence from a single long-range PCR amplicon for 15 common and well-documented HLA-A, HLA-B and HLA-C alleles were obtained.
23237922 HLA-A*24 are associated with the risk of sorafenib-induced high-grade skin rash in Japanese advanced renal cell carcinoma patients.
23220495 Data indicate that HLA-B+07/TPR specific CD8+ T cells express higher levels of PD-1 than HLA-A+02/NLV specific cells.
23202450 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
23200758 Data indicate estimated HLA-A, -B, -C, -DRB1 haplotype and allele frequencies of donors within DKMS German Bone Marrow Donor Center with parentage from 17 different countries.
23178241 The frequencies of the HFE SNPs in ALL pediatric patients were lower than those found in controls, whereas the HLA-A*24 allele was significantly overrepresented in the patients group. No HFE-HLA-A associations were found to modulate the ALL risk.
23176610 TNF-alpha-308 G/A polymorphism was strongly associated with HLA-A*2, -A*33, -B*58, and -DRB1*03 alleles in Han-nationality lung transplant recipients.
23170180 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
23160529 HLA-A*24 independently predicts rapid progression to type 1 diabetes in autoantibody positive relatives and complements other genetic markers for identifying participants in immunointervention trials.
23107309 this result suggests A*02:28-B*15:11-DRB1*09:01 is a conserved HLA haplotype restricted to Taiwanese
23083632 The downregulated expression of HLA-A9 and HLA-A10 by IFN-gamma in schizophrenic patients homozygous for HLA-J M80469.
23061377 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
23019373 T cells engineered with a T cell receptor against the prostate antigen TARP specifically kill HLA-A2+ prostate and breast cancer cells.
22981956 The frequency of HLA-A29 antigens is higher in Type I diabetics with diabetic retinopathy than in those without DR or controls. It may be a susceptibility marker.
22980333 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22972181 The aim of this study was to investigate the association between HLA-A2 and the autoimmune thyroid diseases Graves' disease (GD) and Hashimoto's thyroiditis among Caucasians.
22925811 This study highlights that subtle sequence differences in the infection source may have profound effects on the ability to clear HCV infection in the presence of particular HLA class I alleles.
22923333 Data indicate that the peptide-loading complex (PLC) consists maximally of 2x tapasin-ERp57/MHC I per TAP complex, but one tapasin-ERp57/MHC I in the PLC is essential and sufficient for antigen processing.
22912896 Data suggest that multiplicative interactions of HLA-A and TLR3 gene might be required for the onset of Stevens-Johnson syndrome (SJS)/toxic epidermal necrolysis (TEN) with ocular complications.
22898188 Our findings suggest that the dominant leader peptides uniquely conform to HLA-E, but that in their absence a peptide pool is presented like that of HLA-A*0201.
22887846 findings suggest that A*31:01 might be a multidrug hypersensitivity risk marker
22880099 This study suggests that most of the single nucleotide polymorphisms significantly associated with nasopharyngeal carcinoma from genome-wide association studies reflect previously identified HLA-A associations.
22844345 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22826228 The relative resistance to Nef-mediated down-regulation by the cytoplasmic domains of HLA-B compared with HLA-A contributes to the better control of HIV-1 infection associated with HLA-B-restricted cytotoxic T lymphocytes.
22826228 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22819798 Peptide containing QWNFAGIEAA is a potent Mycobacterium tuberculosis-specific cytotoxic T lymphocytes epitope in HLA-A24 allele.
22818666 unique HIV-1 infected individual homozygous for CCR5-Delta32/Delta32 and carrier of HLA-A*2402 and HLA-B*5701.
22814293 Risk of developing chronic lymphocytic leukemia is influenced by HLA-A class I variation.
22808081 The HLA-A1 and HLA-A2 antigens and not specific single nucleotide variants shared by multiple alleles are responsible for the association with Epstein-Barr Virus.
22784404 Data suggests that HLA-A polymorphism is associated with idiopathic pulmonary fibrosis pathogenesis
22774598 HLA-A* 0206 is strongly associated with Japanese SJS/TEN patients with ocular surface complications.
22767237 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22723329 The strong association of HLA-A*26:01 suggests an important role of MHC class I-mediated presentation of autoantigenic peptides to CD8(+) cytotoxic T cells
22705789 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22664032 Case Report: rare HLA-A25 genotype may result in allele-specific antibodies directed against the common variants, thus leading to unexpected positive cross-match results against apparently matched allografts.
22651890 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22613796 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22573115 when the HLA-B KIR-ligand motif is lacking, the HLA-A KIR-ligand might have a vicarious role in controlling the natural killer cell-mediated innate immune response
22553319 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22544926 Abundant HLA-A*02 self-peptides protect vascular endothelium from cytotoxic T cell (CTL)-mediated lysis by competing for HLA-A*02 binding sites with immunodominant scarcely expressed antigenic peptides.
22537596 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22531911 Melanoma cells present high levels of HLA-A2-tyrosinase in association with instability and aberrant intracellular processing of tyrosinase.
22513782 analysis of a promiscuous survivin-derived T-cell epitope restricted to the HLA-A3 super-type alleles
22504415 The HLA residues A-S(77), A-R(114) and DRbetaN(37) in combination with pulmonary tuberculosis antigenic elements possibly modulate T-cell responses against Mycobacterium tuberculosis that lead to either protection or susceptibility.
22503975 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22492182 Computational prediction and experimental assessment of an HLA-A*0201-restricted cytotoxic T lymphocyte epitope from neutral endopeptidase.
22489945 15 cases of somatic mutations have been reported in the HLA-A and HLA-B genes of patients with a variety of hematologic diseases, including various leukemias and non-Hodgkin's lymphoma.
22489943 Cytokines increase the secretion of HLA-A*32:11Q to detectable levels and result in intracellular accumulation of the allele. On the basis of these results, it is recommended to reclassify the HLA-A*32:11Q allele as a low expression (L) variant.
22487840 Respectively 18, 33 and 13 alleles were observed at HLA-A, B and DRB1 loci.
22480777 Identification of HLA-A*0201-restricted CD8+ T-cell epitope C from hepatitis B virus core protein.
22466790 MICA+ patients were more frequently human leukocyte antigen (HLA) sensitized and regrafted in kidney transplants.
22440091 The segment from D6S211 to D6S510 in HLA complex region might contain nasopharyngeal carcinoma susceptibility loci which indeed needs to be fully investigated in the future.
22424782 We compared secreted and membrane-bound forms of HLA A2 in terms of intracellular trafficking and their bound peptide repertoire
22415262 Results show evidence that HLA class I alleles might be important risk factors for dengue hemorrhagic fever in Brazilian patients.
22402439 The HLA-A-TYR pathway is involved in antigen presentation and risk in generalized vitiligo.
22379998 genome-wide association study results do not support the existence of a clinically relevant common variant for the development of lamotrigine- or phenytoin-induced cutaneous adverse drug reactions (cADRs)
22370889 HLA-A*11 and HLA-B*15 polymorphisms are prevalent in Mongolian and Han children with Henoch-Schonlein purpura.
22355400 HLA-A*02:07 is a predisposing allele for EBV classical Hodgkin lymphoma (cHL) and a protective allele for EBV- cHL in the northern Chinese population
22310618 There was little correlation between HLA sensitization and HLA alleles of oneself. High frequency alleles and the specificity of high-frequency HLA antibodies were not consistent.
22301152 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22301137 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22293801 HLA-B54 and HLA-A11 were positively associated with diffuse panbronchiolitis in Northern and Southern Chinese, respectively.
22291187 A Melan-A long peptide, bearing an optimized analog of immunodominant CD8 epitope (26-35/HLA-A2) gives rise to a sustained high level of cross-presentation by monocyte-derived dendritic cells and generates a large number of tumor-reactive CD8+ T cells.
22258792 HLA-A02* is a valuable prognostic biomarker in epithelial ovarian cancer
22234791 This study indicates a putative association of HLA-A with moyamoya angiopathy in Caucasian patients.
22221707 Studies indicate that the DNA sequence of HLA-A*02:319 is identical to HLA-A*02:07 in exons 2 and 3 but varies with one nucleotide at codon 9 (TTC->TCC).
22211527 HLA-A31 is strongly associated with carbamazepine-induced adverse drug reactions in the Japanese
22175768 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22129495 transplant outcome has not been found to be improved by HLA matching, however a poorer HLA compatibility favored a better graft survival and decreased rejection incidence, with a special relevance for HLA-A matching
22110587 two novel HLA-A0201-restricted cytotoxic T cell epitopes derived from a (-1) frameshift mutation of a coding A(8) tract within the MSH3 gene
22103834 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22103833 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22103831 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
22074999 Data show that the most prevalent alleles at the four loci in the black population were A*30:01, B*58:02, C*06:02, and DRB1*13:01 and in the Caucasian population were A*02:01:01, B*07:02:01, C*07:01, and DRB1*03:01.
22074997 Data show that HLA-A24-restricted, mammaglobin-A (Mam-A) derived, CD8(+) cytotoxic T lymphocyte (CTL) epitopes that can potentially be employed for Mam-A-based breast cancer vaccine therapy to breast cancer patients with HLA-A24 phenotype.
22057263 This study found HLA-A 0207 in patients with familial myasthenia gravis.
22034849 The new HLA-A*33:25 allele has been identified in the Korean population; it differs from A*33:03:01 by one nucleotide in exon 4 (c.778G>A), which results in an amino acid change at codon 236 [GCA-->ACA (Ala>Thr)] in the protein-binding domain.
21994772 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
21963603 Data show that the missing HLA-alleles in 6pLOH(+) clones were conspicuously biased to particular alleles, including HLA-A*02:01, A*02:06, A*31:01, and B*40:02.
21947186 The expression of HLA-A mRNA in peripheral blood mononuclear cells from colorectal cancer group was significantly lower than those in both benign group and healthy group.
21943705 the structures of HLA-A*0301 with two HIV-derived immunodominant T cell epitopes were solved and their characteristics in comparison with HLA-A*1101 presenting the same peptides were analyzed
21929573 Frequency of HLA-A, -B and -DRB1 specificities and haplotypic associations in the population of Castilla y Leon (northwest-central Spain).
21922073 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
21917951 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
21861776 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
21858133 Data show that HLA-A*68:02 and the B*42-C*17 haplotype in HESN partners were significantly and independently associated with faster HIV-1 acquisition.
21851420 HLA-A*11, A*31 and B*54 showed increased phenotype frequencies in polycystic ovarian syndrome women compared to controls.
21849975 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
21833019 Our studies have identified three specific alleles, HLA-A*33:01, HLA-B*44:03, and HLA-DRB1*07:01, to be significantly increased in vitiligo patients as compared with controls in both the initial study on North Indians.
21816002 The frequencies of human leucocyte antigen (HLA)-A, -B and -DRB1 alleles and haplotypes were statistically analysed among 3238 donors from Chinese Marrow Donor Program (CMDP) Jiangsu Branch.
21806781 An HLA-A allele, A*11:90, found in a Taiwanese cord blood sample using DNA sequence-based typing, is reported.
21778700 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
21762823 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
21732917 Characterization of 236 novel alleles at the HLA-A, -B, -C, -DRB1, -DQB1 and -DPB1 loci
21712058 Data show that a total of 49, 86, 50, 63, and 24 HLA-A, -B, -C, -DRB1, and -DQB1 alleles were observed.
21710262 A novel HLA-A2-restricted cytotoxic T lymphocyte epitope from cancer-testis antigen PLAC1 has been identified in breast cancer.
21705623 Mycobacterium leprae-specific peptide ML1417c p113-121 plays an in vivo role and has a functional profile via induction of CD8+ T cells in HLA-A*0201 transgenic mice
21692992 sequence of A*31:30 is identical to that of A*31:01:02 in exons 2 and 3, except one nucleotide (n.t.) substitution c.539T > G resulting in p.Leu180Trp
21692558 HBx is a potential HLA-A0201 restricted cytotoxic T lymphocyte epitope.
21690332 In this review, KIR3DL1/S1 receptor recognition of the Bw4 epitope of HLA-A and -B antigens makes this receptor one of the most extensively studied of the variable natural killer (NK) cell receptors.
21677135 The ability of antibody-mediated CD8 engagement to deliver an activation signal underscores the importance of CD8 in CD8-positive T cell signaling.
21670772 there is synergism between the HLA-DQB1 * 0301 and HLA-A * 0201 alleles with genotype rs12979860 CC, which increases the sustained virological response rate.
21659045 This study will serve as a reference for further anthropological studies, as well as studies of HLA and disease associations in the Moroccan population
21645925 we present the complex structures of human CD8alphaalpha bound to HLA-A*2402
21644228 Nucleotide sequence alignments with HLA-A allele from the IMGT/HLA Sequence Database showed that the novel A*02 variant allele differed from the closest allele A*02:01:01:01 by nt 383 G to C (codon 128 GAG to GAC) in exon 3
21551190 It is proposed at at least part of the protective effect of HLA-A*03 results from targeting of this key epitope in a functional site: the requirement for two mutations to balance fitness and escape provides an initial host advantage.
21543847 The structure of the human major histocompatability (MHC) class I molecule HLA-A*0301 (HLA-A3) in complex with a nonameric peptide (KLIETYFSK) has been determined by X-ray crystallography to 2.7 A resolution.
21543478 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
21538979 study reports three HLA-A2 structures with the immunodominant hepatitis B core antigen 18-27 (HBcAg18-27) epitope, namely A*02:03, A*02:06, and A*02:07 at resolutions of 2.16, 1.70, and 1.75 A respectively
21518758 Tapasin discriminates peptide-human leukocyte antigen-A*02:01 complexes formed with natural ligands.
21515791 Data show that HLA-presented MIF peptides show promise as prognostic cell surface indicators for IDC and as targets for immunotherapeutic intervention.
21498667 findings show that HLA-A*7401 is associated with favorable viremic control in extended southern African cohorts of >2100 C-clade-HIV infected subjects
21482738 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
21482733 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
21459456 The study suggests the possible existence of a susceptibility locus for schizophrenia within the HLA region.
21447147 Characterization of three new alleles HLA-A*02:241, HLA-A*02:242 and HLA-A*30:04:02
21429233 HLA-A*02:07, A*26:01, and A*30:04 were associated with increased risk for Behcet Disease, while HLA-A*33:03 with decreased risk
21428769 The presence of the HLA-A*3101 allele was associated with carbamazepine-induced hypersensitivity reactions among subjects of Northern European ancestry.
21422676 Tissue antigen HLA-A*29 may be a preventive factor against nodal generalized osteoarthritis in patients living in the western Black Sea region of Turkey.
21417892 The researchers evaluated the HLA-A locus and found that current Aleut populations are closer genetically to Europeans than Eskimos and Native Americans.
21362330 Results suggest that APM component defects are a mechanism underlying HLA-I antigen down-regulation in ESCC lesions, and indicate that the loss expression of HLA-I and APM components will become an important marker of ESCC and
21362146 The identification and sequence analysis of a new HLA-A11* variant, A*11:60 allele, found in a Taiwanese leukaemic patient and his siblings, is reported.[HLA-A*11:60]
21352198 Data suggest that HLA class I antigens contribute to tumour antigen-specific cellular immune response most probably by mediating the interactions between tumour cells and CD8(+) T cells.
21342137 Systemic lupus erythematosus is associated with HLA-A, HLA-B, and HLA-DRB1 alleles in Pakistani population.
21303861 The findings of this study indicated that Smoking and human HLA-A interact to increase the risk for multiple sclerosis.
21282516 Complexes of human antigen D and Tax epitopes with HLA-A2 are imperfect structural mimics; both are recognized by alphabeta T cell receptor with the same traditional binding mode used to engage Tax peptide.
21282510 HLA-A2 individuals with a more extensive naive Arg-Ser (RS) repertoire, especially those that use the "long P nucleotide" mechanism, are more resilient in their responses to the influenza M1(58-66) epitope.
21270202 Interferon-associated type 1 diabetes is characterized clinically by high titers of GAD65 antibodies and preserved beta-cell function, and genetically by addition of HLA-A*2402to DRB1*1302-DQA1*0102-DQB1*0604
21209113 Nef-mediated evasion of host immune responsiveness might be attributable to modulation of cell surface expression of major histocompatibility complex class I.
21209113 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
21179106 an association of HLA-A(*)02:06 with susceptibility to Juvenile idiopathic arthritis (JIA) accompanied by uveitis, which might be considered a separate clinical JIA entity.
21165790 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
21165574 The identification of the MCAK/HLA-A*0201 and *2402 peptides suggests the possibility of designing peptide-based immunotherapeutic approaches that might prove effective in treating patients with MCAK-positive cancer.
21149285 HLA-A*3101 allele is a genetic risk factor for carbamazepine-induced cutaneous adverse drug reactions in Japanese population.
21108609 HLA-A23(9) and DQ7(3) antigens may have a role in renal cell carcinoma
21105039 HLA-A*0201 cell line could activate the specific T cells if pulsed with peptide, but endogenous peptide levels were insufficient for activation
21089677 HLA-A0205 and HLA-A30 may not be related to latent autoimmune diabetes in Chengdu Hans.
21087485 Observational study of gene-disease association. (HuGE Navigator)
21079793 Findings could be valuable for HLA matching in clinical bone marrow transplantation, HLA-linked disease-association studies, population genetics, human identification and paternity tests in forensic sciences.
21079793 Observational study of genotype prevalence. (HuGE Navigator)
21068258 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
21059899 Observational study of gene-disease association. (HuGE Navigator)
21058939 A novel allele, HLA-A*11:01:10, identified by sequence-based typing in a Chinese individual
21049023 Observational study of gene-disease association. (HuGE Navigator)
21040492 Observational study of gene-disease association. (HuGE Navigator)
21029668 Bw4 motifs can increase the CD4 cell count and decrease the viral load of patients with primary HIV infection.
21029668 Observational study of gene-disease association. (HuGE Navigator)
20974205 Observational study of gene-disease association. (HuGE Navigator)
20970669 Observational study of gene-disease association. (HuGE Navigator)
20937338 Observational study of gene-disease association. (HuGE Navigator)
20931685 Observational study of gene-disease association. (HuGE Navigator)
20927388 Observational study of gene-disease association. (HuGE Navigator)
20923372 Observational study of gene-disease association. (HuGE Navigator)
20923327 Observational study of genotype prevalence. (HuGE Navigator)
20868569 HLA-A*2601 is possibly associated with ocular Behcet's disease (BD), independent of HLAB* 5101, indicating that HLA-A*2601 is an additional susceptibility allele candidate of ocular BD in Japan.
20858522 This is the first report that shows the transformation of a functional HLA-A*24 gene into a pseudogene by a partial deletion.
20851016 Observational study of gene-disease association. (HuGE Navigator)
20844028 The HLA-A 2402 complexed with SARSV N1 showed a novel host strategy to present an immunodominant CTL epitope by intrachain hydrogen bond as a featured epitope.
20813390 The authors show that the human papillomavirus 16 E5 protein-induced reduction of HLA-A2 has a functional impact by reducing recognition of E5 expressing cells by human papillomavirus specific CD8+ T cells.
20812845 Maternal HLA-A*2301 was associated with increased transmission risk before and after adjusting for maternal viral load
20812845 Observational study of gene-disease association. (HuGE Navigator)
20800922 Observational study of gene-disease association. (HuGE Navigator)
20798335 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20739684 Observational study of gene-disease association. (HuGE Navigator)
20736246 HLA class I single nucleotide polymorphism rs6457110 is associated with infectious mononucleosis and multiple sclerosis
20736246 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20723328 Observational study of gene-disease association. (HuGE Navigator)
20722701 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20715101 HER2 over-expressing tumors may be more prone to escape from HLA-A2 restricted cytotoxic T lymphocytes.
20713950 Observational study of gene-disease association. (HuGE Navigator)
20707881 The peptide-binding motif of A*0302 differs significantly from the previously published HLA-A*0301 and the Glu152Val/Leu156Gln mismatches appear to have a significant impact on the peptide-binding features of A*0302 and A*0301.
20702582 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
20692483 Observational study of gene-disease association. (HuGE Navigator)
20684489 Observational study of gene-disease association. (HuGE Navigator)
20679961 Observational study of genetic testing. (HuGE Navigator)
20678810 The HLA class I region contains two factors modulating multiple sclerosis risk, characterized by independent associations with HLA-A and HLA-C.
20678810 Observational study of gene-disease association. (HuGE Navigator)
20670332 Observational study of genotype prevalence. (HuGE Navigator)
20668555 Observational study of gene-disease association. (HuGE Navigator)
20666704 Observational study of genotype prevalence. (HuGE Navigator)
20660184 Observational study of gene-disease association. (HuGE Navigator)
20650849 The regulatory regions are tightly linked with exons in most of HLA-A alleles excluding A*24020101.
20637045 Observational study of genotype prevalence. (HuGE Navigator)
20631027 Observational study of gene-disease association. (HuGE Navigator)
20622010 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
20619457 The structures of HLA-A*0201 bound to the native 126-134 epitope of the WT1 peptide & its R1Y variant were determined. R1Y alters the positions of MHC charged side chains near the N-terminus & reduces peptide/MHC electrostatic surface potential.
20613458 Observational study of gene-disease association. (HuGE Navigator)
20610889 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20608062 Observational study of gene-disease association. (HuGE Navigator)
20600449 Phylogenetic trees with ancestral character state reconstruction show that the HLA-A02, A03, and A24 supertypes largely form clades with a single ancestral origin while HLA-A01 shows multiple independent origins all from HLA-A03 ancestors.
20600444 Observational study of genotype prevalence. (HuGE Navigator)
20600442 Observational study of gene-disease association. (HuGE Navigator)
20595243 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
20594957 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
20567513 Observational study of gene-disease association. (HuGE Navigator)
20559009 HLA-A33 allele occurres more often in healthy control group, may play protective role in chronic spontaneous urticaria in polish patients
20559009 Observational study of gene-disease association. (HuGE Navigator)
20550778 Observational study of gene-disease association. (HuGE Navigator)
20549830 Observational study of gene-disease association. (HuGE Navigator)
20548248 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20547426 Observational study of gene-disease association. (HuGE Navigator)
20537664 Observational study of gene-disease association. (HuGE Navigator)
20536993 Observational study of gene-disease association. (HuGE Navigator)
20536911 substitution at residue 9 resulting from an HLA-A*02 polymorphism was significantly associated with the risk of severe acute GVHD in patients receiving unrelated hematopoietic stem cell transplantation.
20536911 Observational study of gene-disease association. (HuGE Navigator)
20519398 Observational study of gene-disease association. (HuGE Navigator)
20518846 Observational study of genotype prevalence. (HuGE Navigator)
20518845 Observational study of genotype prevalence. (HuGE Navigator)
20504258 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20501960 There was an inverse association between HLA-A*0206 and cervical cancer risk among Japanese women, which suggests that HLA-A polymorphism influences cervical cancer risk.
20501960 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20493227 Studies identified 51 A, 121 B, and 53 DRB1 alleles in Taiwanese group, and 17 A, 32 B, and 23 DRB1 alleles in Taiwanese aborigines, and findings may provide useful information in search for HLA-matched donors for patients.
20493227 Observational study of genotype prevalence. (HuGE Navigator)
20492599 Observational study of genotype prevalence. (HuGE Navigator)
20492597 Observational study of gene-disease association. (HuGE Navigator)
20492596 Observational study of gene-disease association. (HuGE Navigator)
20483367 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20478772 Observational study of gene-disease association. (HuGE Navigator)
20462405 Observational study of genotype prevalence. (HuGE Navigator)
20454561 These findings highlight HLA-A*0201 matched allogeneic pDCs as potent inducers of tumor immunity.
20449807 Observational study of gene-disease association. (HuGE Navigator)
20448347 HLA-A, -B and -DRB1 alleles and haplotypes are highly polymorphic in the Miao population, and are most similar to that of the South China population.
20448347 Observational study of genotype prevalence. (HuGE Navigator)
20438789 Observational study of gene-disease association. (HuGE Navigator)
20426625 Observational study of gene-disease association. (HuGE Navigator)
20388056 Meta-analysis of gene-disease association. (HuGE Navigator)
20385791 Observational study of gene-disease association. (HuGE Navigator)
20380698 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
20335254 correlation between the ability of HLA-A*1101-restricted CTLs recognizing immunodominant epitopes in vitro and the selection of hiv-1 escape mutants
20335219 Observational study of gene-disease association. (HuGE Navigator)
20334121 Observational study of gene-disease association. (HuGE Navigator)
20331834 Observational study of genotype prevalence. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20308568 Observational study of gene-disease association. (HuGE Navigator)
20307907 Observational study of gene-disease association. (HuGE Navigator)
20300120 Results suggested a possible synergistic interaction of CTLA4 with HLA-A 02 and -DPB1 0501 in the susceptibility to TBII-positive GD.
20300120 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20235791 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20230525 Observational study of genotype prevalence. (HuGE Navigator)
20224785 Observational study of gene-disease association. (HuGE Navigator)
20220067 Data show that sequence analysis of peptides revealed no relevant differences to the peptide motif of HLA-A*3001, indicating that the Cys164Ser substitution does not substantially alter the spectrum of presented peptides.
20219611 Observational study of genotype prevalence. (HuGE Navigator)
20212098 The preassembled nature of HLA-A2*0201 trimers generates a robust epitope-specific CD8+ T cell response and shows enhanced survival rate and lower viral burden in the brain of HLA-A2*0201 transgenic mice following lethal West Nile virus (WNV) challenge.
20210918 Observational study of genotype prevalence. (HuGE Navigator)
20200278 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
20196826 Observational study of genotype prevalence. (HuGE Navigator)
20196825 Observational study of genotype prevalence. (HuGE Navigator)
20193031 Observational study of genotype prevalence. (HuGE Navigator)
20174631 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20173792 Observational study of gene-disease association. (HuGE Navigator)
20173784 Observational study of gene-disease association. (HuGE Navigator)
20169624 Observational study of gene-disease association. (HuGE Navigator)
20154067 Observational study of gene-disease association. (HuGE Navigator)
20147981 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20145915 Observational study of gene-disease association. (HuGE Navigator)
20141578 Observational study of gene-disease association. (HuGE Navigator)
20124097 Studies show that the humanized HLA Tg rabbits appeared to be a useful preclinical animal model for investigating the immunogenicity and protective efficacy of human CD8(+) T cell epitope-based prophylactic vaccines against ocular herpes.
20103633 Data show the downregulation of MHC class I, ERAP1, and ERAP2 in aggressive NB cells is attributable to a low transcriptional availability of NF-kappaB, possibly due to an unknown suppressor other than MYCN.
20097244 Observational study of genotype prevalence. (HuGE Navigator)
20090103 Observational study of gene-disease association. (HuGE Navigator)
20087941 Observational study of gene-disease association. (HuGE Navigator)
20082482 Observational study of gene-disease association. (HuGE Navigator)
20074462 Observational study of gene-disease association. (HuGE Navigator)
20073992 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20072141 Observational study of gene-disease association. (HuGE Navigator)
20069393 Observational study of gene-disease association. (HuGE Navigator)
20065111 This is first evidence of a monoclonal antibody that recognizes a peptide derived from chorionic gonadotropin (hCG)-beta antigen and is capable of suppressing tumor growth, both dose-dependently and in a major histocompatibility (HLA-A*0201) context.
20065064 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
20032191 Observational study of gene-disease association. (HuGE Navigator)
20030786 Observational study of genotype prevalence. (HuGE Navigator)
20012528 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
20012522 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
20003377 Observational study of gene-disease association. (HuGE Navigator)
20003137 Observational study of genotype prevalence. (HuGE Navigator)
20003135 Observational study of genotype prevalence. (HuGE Navigator)
19968064 Observational study of gene-disease association. (HuGE Navigator)
19959637 role of A*2910 allele in the susceptibility to Birdshot retinochoroidopathy
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19934297 Observational study of gene-disease association. (HuGE Navigator)
19932885 gene polymorphism is associated with keloids in chinese population
19932885 Observational study of gene-disease association. (HuGE Navigator)
19931565 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19925877 Observational study of gene-disease association. (HuGE Navigator)
19924143 Observational study of gene-disease association. (HuGE Navigator)
19920778 intralocus and interlocus comparison of mismatched HLA-A and -B specificities with corresponding recipient HLA class I type, and the number, position, and physiochemical disparity (hydrophobicity and electrostatic charge) of polymorphic amino acids
19915238 Apart from other alleles, alleles A2, and B44 play a significant role in vitiligo in the Indian patients
19915238 Observational study of gene-disease association. (HuGE Navigator)
19907433 HLA-A markers and multiple sclerosis susceptibility in the Italian population are reported.
19907433 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19896518 Observational study of gene-disease association. (HuGE Navigator)
19883394 HLA-A down-regulation with promoter methylation of HLA-A locus;promoter hypermethylation might be one of the mechanisms that lead to HLA class I antigen down-regulation in gastric cancer
19879913 Observational study of gene-disease association. (HuGE Navigator)
19865101 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19861144 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19860590 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19850842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19847956 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
19845915 Observational study of genotype prevalence. (HuGE Navigator)
19834793 Observational study of gene-disease association. (HuGE Navigator)
19820376 Observational study of gene-disease association. (HuGE Navigator)
19803716 The results suggest that HLA-A*1101 may be associated with protection against while HLA-B*4006 may be associated with susceptibility to HIV and tuberculosis development in HIV patients.
19802382 dengue virus infection and virus-specific HLA-A2 restricted immune response does not require IL2rgamma
19774073 Observational study of gene-disease association. (HuGE Navigator)
19770068 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
19762282 sHLA-G and sHLA-A, -B, -C serum levels were significantly elevated in HIV-infected subjects as compared with controls before antiretroviral treatment and significantly decreased after 36 months of HAART.
19752231 The elevated binding of HLA-A24(nef) complex to killer cell Ig-like receptor 3DL1 mutant *001 compared with *005 and *015 reflects superior avidity for HLA-A24(nef) rather than greater abundance at the cell surface.
19744147 Thirty-six novel HLA alleles: 7 HLA-A, 11 HLA-B, 15 HLA-C and 3 HLA-DRB1.
19735485 Observational study of genotype prevalence. (HuGE Navigator)
19728932 Observational study of gene-disease association. (HuGE Navigator)
19728333 Data showed HLA-G upregulation and MHC class I downregulation in neoplastic cells.
19727231 Observational study of gene-disease association. (HuGE Navigator)
19718441 Observational study of gene-disease association. (HuGE Navigator)
19714482 Observational study of gene-disease association. (HuGE Navigator)
19703245 Observational study of gene-disease association. (HuGE Navigator)
19703234 Observational study of genotype prevalence. (HuGE Navigator)
19703232 analysis of allele HLA-A*3116 found in a family of a leukaemia patient with Caucasian and Caribbean origin [case report]
19694795 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19684014 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19683555 Observational study of gene-disease association. (HuGE Navigator)
19683024 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19668019 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19664746 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19663693 Observational study of gene-disease association. (HuGE Navigator)
19654877 Observational study of gene-disease association. (HuGE Navigator)
19654407 Observational study of gene-disease association. (HuGE Navigator)
19653987 Observational study of gene-disease association. (HuGE Navigator)
19643141 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
19630074 Observational study of gene-disease association. (HuGE Navigator)
19589487 Observational study of gene-disease association. (HuGE Navigator)
19571811 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19561534 Data show that mice express human CEA, present epitopes solely through HLA-A2.1 molecules and constitute a unique in vivo animal model to study HLA-A2.1-restricted immune response of a human CEA-based vaccine.
19555986 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
19544559 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19539218 Observational study of gene-disease association. (HuGE Navigator)
19536817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19523767 Observational study of gene-disease association. (HuGE Navigator)
19523231 HLA-A*0201-restricted CTL epitope of a novel osteosarcoma antigen, papillomavirus binding factor, is reported.
19502044 Observational study of gene-disease association. (HuGE Navigator)
19500315 Observational study of gene-disease association. (HuGE Navigator)
19495996 Observational study of gene-disease association. (HuGE Navigator)
19493233 Observational study of genotype prevalence. (HuGE Navigator)
19493232 Observational study of gene-disease association. (HuGE Navigator)
19490212 Observational study of gene-disease association. (HuGE Navigator)
19490211 Observational study of genotype prevalence. (HuGE Navigator)
19487887 Observational study of gene-disease association. (HuGE Navigator)
19482867 DRB1*15 increased the risk of developing multiple sclerosis and HLA-A*02 decreased the risk
19482867 Observational study of gene-disease association. (HuGE Navigator)
19480851 Observational study of genotype prevalence. (HuGE Navigator)
19449444 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
19429597 Observational study of gene-disease association. (HuGE Navigator)
19428110 HLA-A upregulation in liver cancer was mediated by both increased nuclear aggregation of transcription factor p65 and upregulation of transcription factor IRF-1.
19409091 Observational study of gene-disease association. (HuGE Navigator)
19407364 Observational study of gene-disease association. (HuGE Navigator)
19392852 This is a first association study at genetic level identifying HLA-A and HLA-B-related variations in genetic susceptibility to esophageal carcinoma among Chaoshan Han population
19392852 Observational study of gene-disease association. (HuGE Navigator)
19392836 Observational study of gene-disease association. (HuGE Navigator)
19364514 Observational study of genotype prevalence. (HuGE Navigator)
19351501 Results suggest that the three predicted peptides, as modification, might be HLA-A*0201 restricted CTL epitopes.
19350523 Observational study of genotype prevalence. (HuGE Navigator)
19349081 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19348686 Observational study of genotype prevalence. (HuGE Navigator)
19337647 Host HLA polymorphisms are an important factor determining the outcome of hepatitis b infection.
19337647 Observational study of gene-disease association. (HuGE Navigator)
19323028 The frequency of expressed HLA-A24 in malaria-exposed and non-malaria-exposed healthy adults living in northwest and central Thailand was 90% (27/30) and 100% (12/12), respectively
19299434 Observational study of gene-disease association. (HuGE Navigator)
19278738 Observational study of gene-disease association. (HuGE Navigator)
19276793 Observational study of gene-disease association. (HuGE Navigator)
19265139 Endogenous HLA-A1 and -A66 as well as transfected HLA-A2 heavy chains in beta 2-microglobulin-defective Burkitt lymphoma Daudi cells are capable of being expressed on the tumor cell surface, although at low levels, and exclusively as immature glycoforms.
19254258 Observational study of genotype prevalence. (HuGE Navigator)
19246116 Observational study of gene-disease association. (HuGE Navigator)
19235017 Observational study of gene-disease association. (HuGE Navigator)
19232441 Observational study of gene-disease association. (HuGE Navigator)
19227412 Observational study of gene-disease association. (HuGE Navigator)
19223392 Observational study of gene-disease association. (HuGE Navigator)
19219503 Observational study of gene-disease association. (HuGE Navigator)
19214504 Observational study of gene-disease association. (HuGE Navigator)
19200828 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19199259 Observational study of gene-disease association. (HuGE Navigator)
19196481 Observational study of gene-disease association. (HuGE Navigator)
19195705 Stimulation with IFN-gamma and/or TNF-alpha led to an increase of HLA-A*3014L secretion to a detectable level and increased HLA-A*3001 expression up to 8-fold.
19180512 Observational study of gene-disease association. (HuGE Navigator)
19167759 Observational study of gene-disease association. (HuGE Navigator)
19165231 Observational study of gene-disease association. (HuGE Navigator)
19159415 Observational study of gene-disease association. (HuGE Navigator)
19155500 The binding affinity of HLA-A epitopes is significantly higher than that of HLA-B epitopes and gives rise to new hypotheses concerning the mechanisms underlying immunodominance of CD8-positive T cell responses against intracellular infectious agents.
19149577 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
19148489 Observational study of gene-disease association. (HuGE Navigator)
19143818 Observational study of gene-disease association. (HuGE Navigator)
19143813 Observational study of gene-disease association. (HuGE Navigator)
19143812 Observational study of gene-disease association. (HuGE Navigator)
19140832 HLA allele and haplotype frequencies in addition to phylogenetic tree and principal component analyses based on the four-digit sequence-level allele frequencies for HLA-A, HLA-B, and HLA-DRB1 showed that Western Javanese was closest to Southeast Asians.
19140832 Observational study of genotype prevalence. (HuGE Navigator)
19127112 Observational study of genotype prevalence. (HuGE Navigator)
19112225 We found a significantly higher frequency of the alleles HLA-A1, HLA-A26 and HLA-DR11 in renal cell carcinoma patients compared to the control group.
19104471 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19100395 HLA-A mRNA levels may provide an effective and reliable indicator to predict acute rejection episodes in renal transplantation.
19096254 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19091857 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
19063987 Observational study of gene-disease association. (HuGE Navigator)
19054371 Observational study of genotype prevalence. (HuGE Navigator)
19052350 Observational study of gene-disease association. (HuGE Navigator)
19047245 HLA-A33 gene is most significantly susceptible to enterovirus 71.
19047245 Observational study of gene-disease association. (HuGE Navigator)
19046300 Observational study of gene-disease association. (HuGE Navigator)
19033208 Observational study of gene-disease association. (HuGE Navigator)
19030725 Observational study of gene-disease association. (HuGE Navigator)
19024262 Observational study of genotype prevalence. (HuGE Navigator)
19023492 Observational study of gene-disease association. (HuGE Navigator)
19019964 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19000146 These results are congruent with historical sources and other genetic studies that support the finding that the Guinea-Bissau genetic pool was influenced by several migrations from North Africa, Sahara and East Africa.
19000146 Observational study of genotype prevalence. (HuGE Navigator)
19000143 Observational study of gene-disease association. (HuGE Navigator)
19000142 Observational study of genetic testing. (HuGE Navigator)
19000140 Observational study of genotype prevalence. (HuGE Navigator)
18987644 Observational study of gene-disease association. (HuGE Navigator)
18982067 Data demonstrate that the influence of ZNRD1 alleles on disease progression rates are attributable to HLA-A10, help clarify the relationship between the HCP5, HLA-C and HLA-B*57 alleles, and reaffirm a critical role of HLA-B*57 alleles in HIV disease.
18982067 Observational study of gene-disease association. (HuGE Navigator)
18976440 Observational study of gene-disease association. (HuGE Navigator)
18976432 Observational study of genotype prevalence. (HuGE Navigator)
18971283 Observational study of gene-disease association. (HuGE Navigator)
18958335 Observational study of gene-disease association. (HuGE Navigator)
18949728 Observational study of gene-disease association. (HuGE Navigator)
18939942 Observational study of gene-disease association. (HuGE Navigator)
18936542 HLA-A may be involved in the pathogenesis of Alzheimer's disease
18936542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18922348 Present results suggest that there is a significant relationship between nasal polyposis and HLA-A allele frequency among the Turkish population.
18922348 Observational study of gene-disease association. (HuGE Navigator)
18852273 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18848853 Observational study of genotype prevalence. (HuGE Navigator)
18846964 Observational study of gene-disease association. (HuGE Navigator)
18827882 Frequency of the HLA-A*24 increased in dengue shock syndrome patients.
18808677 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18801059 All HLA-A2-positive patients expressed the HLA-A*0201 allele as determined by high resolution typing
18797890 Observational study of gene-disease association. (HuGE Navigator)
18786593 No significant differences of these allelic frequencies were found between the patients and the control subjects, suggesting that the HLA-A gene was unlikely a major risk factor of schizophrenia in Han Chinese from Taiwan.
18786593 Observational study of gene-disease association. (HuGE Navigator)
18782112 Soluble HLA-A serum level is significantly increased in allergic rhinitis patients with pollen allergy.
18778326 Observational study of gene-disease association. (HuGE Navigator)
18770861 CDCA1 may therefore be an ideal tumor-associated antigen useful for the diagnosis and immunotherapy of these cancer
18769915 A biochemical HLA-A*3001 binding assay & a large panel of nonamer peptides & peptide libraries demonstrated that the specificity of HLA-A*3001 most closely resembles that of the HLA-A3 supertype.
18768435 Observational study of gene-disease association. (HuGE Navigator)
18761557 Observational study of gene-disease association. (HuGE Navigator)
18755927 In lung transplaant patients HLA-A3 was strongly linked to post-transplant lymphoproliferative disease (PTLD) and may be a novel marker of PTLD risk.
18725938 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18721271 HLA-A, -B and -DRB1 allele frequencies in the Bangladeshi population.
18721271 Observational study of genotype prevalence. (HuGE Navigator)
18718089 The gene frequency of HLA-A*24, HLA- DRB1*14 in CML patients is significantly lower than normal people in Guangdong.
18718089 Observational study of gene-disease association. (HuGE Navigator)
18716994 Observational study of genotype prevalence. (HuGE Navigator)
18689790 Observational study of gene-disease association. (HuGE Navigator)
18684953 Observational study of gene-disease association. (HuGE Navigator)
18684101 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18683155 Observational study of genotype prevalence. (HuGE Navigator)
18672082 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18653452 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18613417 Observational study of gene-disease association. (HuGE Navigator)
18589099 Observational study of gene-disease association. (HuGE Navigator)
18583252 Observational study of gene-disease association. (HuGE Navigator)
18582515 Observational study of gene-disease association. (HuGE Navigator)
18580606 Observational study of gene-disease association. (HuGE Navigator)
18578977 Observational study of gene-disease association. (HuGE Navigator)
18571006 Observational study of gene-disease association. (HuGE Navigator)
18566379 HER-2(10(85))-specific human CTL recognized the HER-2/neu+ HLA-A2.1+ tumor cell line SKBR3.A2
18544086 Observational study of gene-disease association. (HuGE Navigator)
18541215 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18521626 Observational study of gene-disease association. (HuGE Navigator)
18520158 Observational study of gene-disease association. (HuGE Navigator)
18517005 The significant increase of HLA-A* 26 in the BD patients without HLA-B*51 suggests that this allele itself might be one of the primary susceptibility genes involved in the development of BD independently of HLA-B*51.
18517005 Observational study of gene-disease association. (HuGE Navigator)
18502829 expression of HLA A*2301, A*2402, or A*3201 but not HLA A*2501 protects target cells from lysis by KIR3DL1(+) NK cells
18501999 Observational study of gene-disease association. (HuGE Navigator)
18486765 Observational study of gene-disease association. (HuGE Navigator)
18473783 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18458507 The present study suggest that the susceptibility to advanced endometriosis, unlike in the Japanese population, is not associated with HLA-A antigens in the Korean population.
18458507 Observational study of gene-disease association. (HuGE Navigator)
18451182 Co-occurring HLA alleles across loci seem to be more important than individual allelesin squamous cell cervical cancer risk.
18451182 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18438604 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18434400 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18399156 Observational study of gene-disease association. (HuGE Navigator)
18396213 Observational study of gene-disease association. (HuGE Navigator)
18385790 Observational study of gene-disease association. (HuGE Navigator)
18385451 analysis of the ability of most common HLA-B alleles and HLA-A alleles with Bw4 serologic reactivity to protect target cells from lysis by KIR3DL1-dependent NK cells
18381784 Certain HLA alleles are found in Chinese patients with psoriasis (HLA-A*30, -Cw*06, -DR*07) and psoriatic arthritis (PsA) (HLA-B*27). Psoriasis patients with the HLA-B*27 and/or -Cw*12 may have higher risk of developing PsA.
18381784 Observational study of gene-disease association. (HuGE Navigator)
18370845 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18363871 identified two HLA-A2 restricted T-cell epitopes-TLVTVSSAS and LMISRTPEV--which can yield an expansion of CD8+ T-cells with the ability to kill peptide-loaded target cells and HLA-A2+ IgG+ myeloma cells
18361931 HLA-I serum levels seem to be of prognostic significance in multiple myeloma and might be helpful to identify patients of poor prognosis
18359130 The authors evaluated HLA-A2 association with Alzheimer disease, considering also the possible interaction with APOE pattern, age of onset and gender. No evidence of any association was found.
18359130 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18347914 Observational study of gene-disease association. (HuGE Navigator)
18344933 hla-a haplotypes were associated with higer occurrence of lymphoproliferative disorders after renal transplantation
18344933 Observational study of gene-disease association. (HuGE Navigator)
18340360 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18332066 Observational study of gene-disease association. (HuGE Navigator)
18320121 Observational study of gene-disease association. (HuGE Navigator)
18301962 Observational study of gene-disease association. (HuGE Navigator)
18296443 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18295677 Observational study of genotype prevalence. (HuGE Navigator)
18273034 A population-specific diabetogenic haplotype HLA-A2,Cw1,B56,DR4,DQ8 is associated with high birthweight in Finnish diabetic families.
18273034 Observational study of gene-disease association. (HuGE Navigator)
18256425 Observational study of gene-disease association. (HuGE Navigator)
18244920 We investigated the genetic polymorphisms of HLA-A, B, DRB1 alleles and haplotype frequencies in Mongols from Inner Mongolia, China.
18241227 Observational study of gene-disease association. (HuGE Navigator)
18240960 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18236804 Observational study of gene-disease association. (HuGE Navigator)
18223493 Observational study of gene-disease association. (HuGE Navigator)
18201363 A novel human leukocyte antigen (HLA) A*24 allele was identified in the Korean population and designated HLA-A*2475
18190553 Meta-analysis of gene-disease association. (HuGE Navigator)
18186801 In this study, samples from 95 SARS patients and 403 healthy controls were typed for HLA-A, -B and -DRB1 alleles and no association was found between HLA variations and SARS.
18186801 Observational study of gene-disease association. (HuGE Navigator)
18155264 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18097038 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18093280 Observational study of gene-disease association. (HuGE Navigator)
18088468 HLA-A*2301 gene may be considered as a risk marker of aplastic anemia.
18088468 Observational study of gene-disease association. (HuGE Navigator)
18086267 Observational study of genotype prevalence. (HuGE Navigator)
18085998 Observational study of gene-disease association. (HuGE Navigator)
18082573 Observational study of genotype prevalence. (HuGE Navigator)
18078206 The researchers investigated the frequency of HLA-A, HLA-B, and HLA-DR allele polymorphisms in Sicily and found evidence of genetic differentiation between the western and eastern sides of Sicily.
18074415 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18073204 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18070207 Observational study of gene-disease association. (HuGE Navigator)
18069934 Thirty-two novel human leukocyte antigen-A alleles are described.
18065518 Observational study of gene-disease association. (HuGE Navigator)
18064508 polymorphisms in some alleles of B and C in HLA class I genes are associated with Kawasaki disease in Korean children.
18064508 Observational study of gene-disease association. (HuGE Navigator)
18057683 Observational study of gene-disease association. (HuGE Navigator)
18057255 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18035044 These findings indicate different immunodominance of Gag169-177 epitope among 3 HLA-A( *)26 subtypes.
18022727 Observational study of gene-disease association. (HuGE Navigator)
18005690 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18005680 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
18004301 pinpoint disease susceptibility to the MHC class I genes HLA-B and HLA-A, in addition to the established associations of the MHC class II genes
18001297 Observational study of genotype prevalence. (HuGE Navigator)
17997746 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17989838 Observational study of gene-disease association. (HuGE Navigator)
17989341 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17971052 Observational study of gene-disease association. (HuGE Navigator)
17971048 Observational study of gene-disease association. (HuGE Navigator)
17964196 Observational study of gene-disease association. (HuGE Navigator)
17961775 Observational study of genotype prevalence. (HuGE Navigator)
17956696 Observational study of genotype prevalence. (HuGE Navigator)
17927716 Observational study of gene-disease association. (HuGE Navigator)
17924859 Observational study of gene-disease association. (HuGE Navigator)
17924859 The A1-B8 haplotype hitchhiking with the hemochromatosis C282Y mutation was not associated with a more efficient iron absorption
17922429 results suggest that HLA genotype relates to the muscular necrosis and the pathogenesis of Duchenne muscular dystrophy
17922429 Observational study of gene-disease association. (HuGE Navigator)
17911430 Observational study of gene-disease association. (HuGE Navigator)
17909631 Observational study of gene-disease association. (HuGE Navigator)
17900288 Observational study of genotype prevalence. (HuGE Navigator)
17891921 Observational study of genotype prevalence. (HuGE Navigator)
17878955 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
17869653 Observational study of genotype prevalence. (HuGE Navigator)
17853492 analysis of T-cell response against autologous pleomorphic malignant fibrous histiocytoma antigen presented by retrieved HLA-A*0206
17845299 HLA-A*02 was suntyped in 101 Sinhalese and there was observed a preponderance of the rare allele HLA-A*0211 which was similar to reported frequencies in northern India.
17825227 HLA-A * 02, HLA-B * 58 and HLA-DRB1 * 03 might be the susceptible genes of NPC patients while HLA-B * 40 might be the protective gene of NPC patients.
17825227 Observational study of gene-disease association. (HuGE Navigator)
17785583 Observational study of gene-disease association. (HuGE Navigator)
17784873 Data show that TTK protein kinase, lymphocyte antigen 6 complex locus K and insulin-like growth factor (IGF)-II mRNA binding protein 3 are tumor-associated antigens recognized by cytotoxic T lymphocytes and HLA-A24-restricted epitope peptides.
17763415 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17726164 Observational study of gene-disease association. (HuGE Navigator)
17719062 Data show that the MAT-1 26-35 and 27-35 peptides adopt strikingly different conformations when bound to HLA-A2.
17715334 Observational study of gene-disease association. (HuGE Navigator)
17701131 HFE polymorphism are potentially important predictors of ALT flare-up.
17668896 A T helper effect was demonstrated in HLA-A and HLA-DR1 trangenic mice, and it was particularly strong with epitopes Gag(301-320),Gag(321-340 )and Gag(271-290)
17662350 Observational study of gene-disease association. (HuGE Navigator)
17662350 frequency of HLA antigens was significantly increased suggesting that brain cavernoma susceptibility may be associated with HLA antigens
17662002 Observational study of gene-disease association. (HuGE Navigator)
17662002 This study analysed the effect of HLA-A on clinical variables in a large Scandinavian sample set, but could not identify any significant contribution from HLA-A on the clinical phenotype in MS.
17661908 Observational study of gene-disease association. (HuGE Navigator)
17653284 The combination of HLA-A and HLA-DRB1 alleles have been found to influence risk of muliple sclerosis 23-fold.
17653284 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17652849 Observational study of gene-disease association. (HuGE Navigator)
17632570 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
17632197 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
17630352 Observational study of gene-disease association. (HuGE Navigator)
17630352 HLA-A*02 is associated with a reduced risk and HLA-A*01 with an increased risk of developing EBV+ Hodgkin lymphoma.
17629023 Observational study of gene-disease association. (HuGE Navigator)
17624664 HLA-A *0201 restricted ALCAM peptides primed autologous CD8(+) T cells to elicit cytotoxic response against ALCAM(+) human cancer cells.
17620420 The human versions of HLA-A*0201 , differing from the murine peptides by only a single residue, represent a candidate to explore as CD8(+) T-cell targets in HLA-A*0201-positive type 1 diabetic patients.
17610418 Observational study of genotype prevalence. (HuGE Navigator)
17609824 Observational study of gene-disease association. (HuGE Navigator)
17604883 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
17604825 Observational study of gene-disease association. (HuGE Navigator)
17603847 Observational study of gene-disease association. (HuGE Navigator)
17586321 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
17584771 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17581864 Depleting AP-2 potentiates Nef activity by altering the membrane composition and dynamics of endosomes and causing increased delivery of HLA-A2 to a prelysosomal compartment.
17581864 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
17578051 Observational study of gene-disease association. (HuGE Navigator)
17573956 Observational study of gene-disease association. (HuGE Navigator)
17554059 Observational study of gene-disease association. (HuGE Navigator)
17546694 Observational study of gene-disease association. (HuGE Navigator)
17509453 Observational study of genotype prevalence. (HuGE Navigator)
17509091 Observational study of gene-disease association. (HuGE Navigator)
17504510 Observational study of genotype prevalence. (HuGE Navigator)
17498269 Observational study of gene-disease association. (HuGE Navigator)
17493347 Observational study of genotype prevalence. (HuGE Navigator)
17491685 Meta-analysis of gene-disease association. (HuGE Navigator)
17489060 Observational study of gene-disease association. (HuGE Navigator)
17487448 Observational study of gene-disease association. (HuGE Navigator)
17487448 Increased frequency of HLA A2, A11, and B35 alleles in unselected pediatric Henoch Schonlein purpura patient population may be a risk factor for susceptibility.
17471440 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17462512 Observational study of genotype prevalence. (HuGE Navigator)
17462512 The genetic distance (GD) estimated according to HLA-A, -B, and -C allele frequency indicates that Mongolian and Hui have the closest relationship.
17462511 Observational study of genotype prevalence. (HuGE Navigator)
17460903 Data show that the tetrameric HLA-A* 2402 provides a powerful tool to explore the secrets of CTL responses against HCMV antigens in HLA-A* 2402 individuals.
17460569 Observational study of genotype prevalence. (HuGE Navigator)
17458393 Observational study of gene-disease association. (HuGE Navigator)
17437273 Observational study of gene-disease association. (HuGE Navigator)
17433060 Observational study of gene-disease association. (HuGE Navigator)
17429413 Observational study of gene-disease association. (HuGE Navigator)
17428358 Observational study of gene-disease association. (HuGE Navigator)
17428358 HLA alleles A*3001, B*5201, and DRB1*1502 might increase the susceptibility to Takayasu arteritis, while A*2602 might protect against it.
17407088 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17389024 HLA-A*0326 differs from A*030101 in a point mutation at codon 268 (AAG-->GAG), generating an amino acid substitution of K to E
17389023 the novel allele HLA-A*020112 differs from HLA-A*020101 by a synonymous nucleotide exchange at position 53 in exon 2 (G-->A)
17389019 analysis of a new HLA-A*02 allele, (A*0297), identified in a cord blood unit and in her mother
17388919 Observational study of gene-disease association. (HuGE Navigator)
17383044 Observational study of gene-disease association. (HuGE Navigator)
17378697 Observational study of gene-disease association. (HuGE Navigator)
17373939 Observational study of genotype prevalence. (HuGE Navigator)
17349876 HLA-A*68020102 has been isolated and sequenced. This variant shows an 11 base pair deletion within the 5' UTR region. The exon sequence is identical to that of A*6802
17317585 Observational study of gene-disease association. (HuGE Navigator)
17311253 Observational study of gene-disease association. (HuGE Navigator)
17306585 Observational study of genotype prevalence. (HuGE Navigator)
17299710 Observational study of gene-disease association. (HuGE Navigator)
17290883 Observational study of gene-disease association. (HuGE Navigator)
17288808 Observational study of genotype prevalence. (HuGE Navigator)
17284222 HLA-A*9203, found in Taiwan using sequence-based typing method, was identical to HLA-A*0207 in exon 3 but differed in exon 2 by five nucleotide substitutions at positions 240-282 corresponding to three amino acid changes at codons 62, 66 and 70.
17258541 Observational study of gene-disease association. (HuGE Navigator)
17257318 Observational study of genotype prevalence. (HuGE Navigator)
17243956 Meta-analysis of gene-disease association. (HuGE Navigator)
17234427 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17227111 Observational study of gene-disease association. (HuGE Navigator)
17215337 Observational study of gene-disease association. (HuGE Navigator)
17212710 Observational study of genotype prevalence. (HuGE Navigator)
17212707 Observational study of gene-disease association. (HuGE Navigator)
17209778 Observational study of gene-disease association. (HuGE Navigator)
17209778 HLA-A*9 had no association with the generalized aggressive periodontitis.
17207712 Observational study of gene-disease association. (HuGE Navigator)
17186951 Observational study of gene-disease association. (HuGE Navigator)
17186951 HLA-A*02 was significantly higher in the Recovered group than in the Persistent group (P=0.044) of hepatitis B patients.
17182537 This study shows that HLA-A*2402 is a ligand for KIR3DL1 and demonstrates how the binding of KIR3DL1 to Bw4(+) ligands depends upon the bound peptide as well as HLA and KIR3DL1 polymorphism.
17170457 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
17142892 A high-resolution structure of the human MHC-I molecule HLA-A*1101 is presented in which it forms a complex with a sequence homologue of a peptide that occurs naturally in hepatitis B virus DNA polymerase.
17142764 first example of the generation of CTLs in the absence of proliferation of T4 cells (mixed lymphocyte culture) and the description of an aberrant allele, A*0118N, that may behave as a minor histocompatibility Ag, with implications in allorecognition
17142760 proof of principle that it is possible to differentially modulate the IFNgamma-induced expression of the HLA-E and HLA-A genes; stimulation of HLA-A expression by IFN-gamma requires nuclear export of HLA-A mRNA by chromosome maintenance region 1 (CRM-1).
17117954 Observational study of genotype prevalence. (HuGE Navigator)
17116886 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
17106278 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17102800 Schizophrenic carriers of the HLA-A10 genotype were clearly most often infected with Chlamydophila, especially C. psittaci.
17101473 Observational study of gene-disease association. (HuGE Navigator)
17077296 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
17062033 Observational study of gene-disease association. (HuGE Navigator)
17055361 Identification of 4 novel HLA-A alleles (A*9202, A*680105, A*2630, and A*2915) in an East African population.
17026471 Observational study of genotype prevalence. (HuGE Navigator)
17021767 Observational study of gene-disease association. (HuGE Navigator)
16987968 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
16979207 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
16926287 Observational study of gene-disease association. (HuGE Navigator)
16922942 Observational study of gene-disease association. (HuGE Navigator)
16883565 Observational study of genotype prevalence. (HuGE Navigator)
16878186 Observational study of gene-disease association. (HuGE Navigator)
16866885 Observational study of genotype prevalence. (HuGE Navigator)
16866883 Observational study of genotype prevalence. (HuGE Navigator)
16857416 Observational study of gene-disease association. (HuGE Navigator)
16847125 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
16786814 Observational study of gene-disease association. (HuGE Navigator)
16767661 A novel allele of HLA-A has been identified and officially named HLA-A*3308 by standard of the WHO Nomenclature Committee.
16731854 Observational study of gene-disease association. (HuGE Navigator)
16720216 Observational study of gene-disease association. (HuGE Navigator)
16720216 The association and linkage of the class I HLA-A2 allele with autism suggests its involvement in the etiology of autism.
16704965 Observational study of gene-disease association. (HuGE Navigator)
16698425 Observational study of gene-disease association. (HuGE Navigator)
16684552 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
16675560 In hepatocellular carcinoma patients, HLA-A could induce cytotoxic T lymphocytes for glypican 3-based immunotherapy (HLA-A2 AND HLA-A24)
16671946 Observational study of gene-disease association. (HuGE Navigator)
16611249 Observational study of genotype prevalence. (HuGE Navigator)
16609350 Observational study of gene-disease association. (HuGE Navigator)
16608404 Observational study of gene-disease association. (HuGE Navigator)
16604503 Observational study of genotype prevalence. (HuGE Navigator)
16583211 A novel HLA-A allele, HLA-A*0279, was identified.
16538176 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16533342 Observational study of gene-disease association. (HuGE Navigator)
16532100 Observational study of gene-disease association. (HuGE Navigator)
16493087 Transgenic expression in NOD mice of HLA-A*0201, in the absence of murine class I MHC molecules, is sufficient to mediate autoreactive CD8+ T cell responses contributing to development of type 1 diabetes
16481299 Observational study of gene-disease association. (HuGE Navigator)
16481299 The susceptibility to PBC in Chinese individuals is associated with DRB1*0701 allele.
16473309 Observational study of genotype prevalence. (HuGE Navigator)
16463424 Observational study of gene-disease association. (HuGE Navigator)
16459714 Intrathecal production and fluctuations in CSF and serum concentrations of sHLA-I were reciprocal in multiple sclerosis.
16456803 Observational study of genotype prevalence. (HuGE Navigator)
16456797 Observational study of genotype prevalence. (HuGE Navigator)
16454711 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
16451204 Observational study of genotype prevalence. (HuGE Navigator)
16451199 Observational study of genotype prevalence. (HuGE Navigator)
16451198 Observational study of genotype prevalence. (HuGE Navigator)
16441495 Identification of two new HLA-A variants, HLA-A*2911 and HLA-A*6827
16441494 A novel HLA-A*680104 variant
16441493 Identification of a new allele, HLA-A*3308
16441492 Identification of a novel HLA-A*02 allele, A*0287
16441491 HLA-A*2313 is closest to A*2301 but is likely to stimulate T cells when mismatched
16441487 The HLA-A*1115-bearing haplotype was B*350101; Cw*040101; DRB1*140101; DRB3*020201; DQA1*010401; DQB1*0503; DPA1*0103/07; DPB1*030101. Extensive serological typing indicated that this allele essentially encodes a 'normal' HLA-A11 specificity.
16441486 Observational study of genotype prevalence. (HuGE Navigator)
16441486 Gene frequencies and haplotypic associations within HLA-A loci were determined at a high-resolution allelic level and should provide useful information in anthropology, bone marrow donor registry, legal medicine, and disease association studies.
16405603 Observational study of gene-disease association. (HuGE Navigator)
16386651 Observational study of genotype prevalence. (HuGE Navigator)
16386646 Observational study of gene-disease association. (HuGE Navigator)
16365741 Observational study of gene-disease association. (HuGE Navigator)
16365153 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
16361713 Observational study of gene-disease association. (HuGE Navigator)
16354571 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
16343061 Observational study of gene-disease association. (HuGE Navigator)
16331567 HLA-A allele frequency distributions were consistent with the Hardy-Weinberg equilibrium in a group of indigenous Hans in Shenyang, China.
16331510 Observational study of gene-disease association. (HuGE Navigator)
16322289 HLA class I antigen loss was significantly correlated with glioblastoma multiforme
16310048 HLA-A2 mutants with substitutions at known TCR contact sites were compared for recognition by hapten-cross-reactive CTL. Similar AA contacts are made by the TCR during recognition of immunizing or cross-reacting complexes.
16307312 EBV isolates from nasopharyngeal carcinoma of southern China and Taiwan is dominated by an HLA A2-restricted 'epitope-loss variants' of LMP-1
16305683 Observational study of genotype prevalence. (HuGE Navigator)
16272310 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
16267409 Observational study of gene-disease association. (HuGE Navigator)
16235173 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16235173 HLA-A polymorphism is one of the host genetic factors that alter the risk for the development of cervical cancer in Chinese women.
16216678 Observational study of genotype prevalence. (HuGE Navigator)
16215957 The HLA-A,-B,-DRB1 distribution in Shanxi Han population shares some genetic characteristics with other Han populations in northern part of China, but it exhibits its own characteristics.
16215957 Observational study of genotype prevalence. (HuGE Navigator)
16215732 Observational study of genetic testing. (HuGE Navigator)
16185849 Observational study of gene-disease association. (HuGE Navigator)
16185849 The HLA-A*02 and -A*03 were observed increased frequencies in patients less than 50% hair loss, and HLA-B*27 equally in patients of 50-99% hair loss, alopecia totalis and alopecia universalis.
16185329 Observational study of gene-disease association. (HuGE Navigator)
16185325 Observational study of genotype prevalence. (HuGE Navigator)
16174649 Observational study of gene-disease association. (HuGE Navigator)
16173256 Observational study of gene-disease association. (HuGE Navigator)
16156661 A fluorescence polarization competitive peptide-binding assay was tested on a panel of 15 well-defined HLA-A0201 ligands from various sources covering a broad range of binding affinities.
16143070 HLA-A01 alleles in Han population, Gansu province seem to contribute to the genetic susceptibility, while HLA-A11 and -DR03 alleles to the genetic resistance, to leukemia.
16143070 Observational study of gene-disease association. (HuGE Navigator)
16129034 Observational study of gene-disease association. (HuGE Navigator)
16120569 Observational study of genotype prevalence. (HuGE Navigator)
16113298 suballeles of the HLA-A2 supertype can effectively present antigenic epitopes in response to preerythrocytic malarial antigens derived from Malian children
16103458 Observational study of gene-disease association. (HuGE Navigator)
16101834 HLA-A *0101 is mutated in a colorectal tumor cell line
16101833 Observational study of genotype prevalence. (HuGE Navigator)
16095491 anti-HLA class I Abs play an important role in the pathogenesis of obliterative airway disease by inducing growth factor production, apoptosis and chemotaxis of inflammatory cells
16091223 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
16086925 Observational study of gene-disease association. (HuGE Navigator)
16086295 Guangdong Han population in China has twelve HLA-A, 23 B, 11 Cw and 13 DRB1 alleles and a total of 9 HLA-A-B, 20 Cw-B, 7 A-Cw, and 8 A-DRB1, 9 B-DRB1, 10 Cw-DRB1 haplotypes.
16086294 In a northwest Chinese Han population, fifteen alleles for the locus HLA-A, 28 alleles for the HLA-B locus and 13 alleles for the HLA-DRB1 were detected. The results showed that the most frequent HLA alleles found were A02, B13, and DRB1*15.
16053028 Observational study of gene-disease association. (HuGE Navigator)
16041067 the first high-resolution X-ray structure of HLA-A*1101 in complex with a peptide derived from SARS coronavirus (CoV) nucleocapsid protein is described
16029431 Observational study of genetic testing. (HuGE Navigator)
16019679 Observational study of gene-disease association. (HuGE Navigator)
16000390 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
15983206 Identification of HLA-A2-restricted, naturally processed epitopes derived from proinsulin, an autoantigen likely to play an important role in the pathogenesis of type 1 diabetes.
15982259 analysis of HLA-A*2451, a new allele found in a Chinese donor
15982258 new HLA class I alleles found in Caucasian population: A*3012, B*270505, B*3541 and Cw*0716
15982254 Observational study of genotype prevalence. (HuGE Navigator)
15975271 Observational study of gene-disease association. (HuGE Navigator)
15968843 Observational study of gene-disease association. (HuGE Navigator)
15952133 The HLA-DRB1 loci are highly polymorphic in Monba population of Xizang Autonomous Region. Compared with other ethnic groups in China, the Monba ethnic group is close to Tibetan ethnic group.
15940053 Observational study of gene-disease association. (HuGE Navigator)
15935891 Observational study of genetic testing. (HuGE Navigator)
15896206 analysis of novel allele HLA-A*2442
15896205 analysis of novel allele HLA-A*0278
15878340 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
15858601 Observational study of gene-disease association. (HuGE Navigator)
15854903 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
15854278 Observational study of gene-disease association. (HuGE Navigator)
15853906 A new allele, HLA-A* 0261, differs from HLA-A* 020601 by a single-nucleotide substitution at codon 57 (CCG-->GCG) resulting in an amino acid change from Pro to Ala.
15853904 A new alleles, HLA-A*6824, differs from A*680102 by a single nucleotide change at position 275 in exon 2, which results in a conservative amino acid substitution from lysine to arginine in the peptide-binding groove at codon 68.
15853903 Observational study of gene-disease association. (HuGE Navigator)
15853898 Observational study of genotype prevalence. (HuGE Navigator)
15847654 Observational study of genetic testing. (HuGE Navigator)
15836703 Observational study of gene-disease association. (HuGE Navigator)
15809757 ABCE1 and its peptides could be target molecules in specific immunotherapy for HLA-A2(+) colon cancer patients.
15807454 Observational study of gene-disease association. (HuGE Navigator)
15793795 The distribution of HLA-A, -B allele polymorphism in the Luoba nationality is distinctive, but some of the gene distribution in the Luoba group is nearer to that in the Tibetan group.
15793795 Observational study of genotype prevalence. (HuGE Navigator)
15784468 Observational study of gene-disease association. (HuGE Navigator)
15772003 Observational study of genotype prevalence. (HuGE Navigator)
15743917 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15740492 Observational study of gene-disease association. (HuGE Navigator)
15740492 Additional risk of hereditary hemochromatosis given by class I HLA antigens may be secondary to the HFE gene linkage disequilibrium with certain class I alleles or to the existence of other neighboring genetic pathogenetic factors in our Spanish sample.
15726104 Observational study of gene-disease association. (HuGE Navigator)
15701833 Loss of HLA class I gene is associated with pancreatic carcinoma progression
15683420 Observational study of gene-disease association. (HuGE Navigator)
15681828 the T cell epitope HCV core 35-44 stabilizes HLA-A2 and HLA-E and inhibits cytolysis mediated by natural killer cells
15666025 Observational study of genotype prevalence. (HuGE Navigator)
15662734 Observational study of gene-disease association. (HuGE Navigator)
15653685 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
15640334 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15640334 The genetic susceptibility of chronic thromboembolic pulmonary hypertension is controlled by HLA polymorphism.
15638726 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
15631661 Observational study of genotype prevalence. (HuGE Navigator)
15629059 Observational study of genotype prevalence. (HuGE Navigator)
15621102 Observational study of genotype prevalence. (HuGE Navigator)
15613143 Observational study of gene-disease association. (HuGE Navigator)
15611225 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
15607698 Observational study of gene-disease association. (HuGE Navigator)
15596859 transport of HLA-A2 to cell surface disrupted by Nef
15596859 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
15569716 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
15567775 Observational study of genetic testing. (HuGE Navigator)
15555263 Observational study of genotype prevalence. (HuGE Navigator)
15554365 Observational study of gene-disease association. (HuGE Navigator)
15546341 Observational study of genotype prevalence. (HuGE Navigator)
15534563 Observational study of genotype prevalence. (HuGE Navigator)
15498100 Observational study of genotype prevalence. (HuGE Navigator)
15496201 Observational study of genotype prevalence. (HuGE Navigator)
15496200 Observational study of gene-disease association. (HuGE Navigator)
15491536 Observational study of gene-disease association. (HuGE Navigator)
15483462 HTLV-1 Tax protein epitopes were tested for protective efficacy in a preclinical model of infection using HTLV-1 Tax recombinant vaccinia virus and HLA-A*0201 transgenic mice.
15480178 Observational study of gene-disease association. (HuGE Navigator)
15471368 Observational study of gene-disease association. (HuGE Navigator)
15459953 Observational study of genetic testing. (HuGE Navigator)
15455355 Coordinated downregulation of the antigen presentation machinery and HLA class I/beta2-microglobulin complex is responsible for HLA-ABC loss in bladder cancer
15385740 Observational study of gene-disease association. (HuGE Navigator)
15362660 Observational study of gene-disease association. (HuGE Navigator)
15361135 Observational study of genotype prevalence. (HuGE Navigator)
15361126 Observational study of genotype prevalence. (HuGE Navigator)
15323271 Observational study of gene-disease association. (HuGE Navigator)
15321756 Observational study of genotype prevalence. (HuGE Navigator)
15314693 Prevalent expression of the immunostimulatory MHC class I chain-related molecule is counteracted by shedding in prostate cancer.
15307871 Observational study of gene-disease association. (HuGE Navigator)
15304010 Observational study of genetic testing. (HuGE Navigator)
15301866 Observational study of gene-disease association. (HuGE Navigator)
15301865 Observational study of gene-disease association. (HuGE Navigator)
15280452 Observational study of gene-disease association. (HuGE Navigator)
15275783 Observational study of gene-disease association. (HuGE Navigator)
15275783 These results suggest that the HLA-A*3303-B*4403-DRB1*1302 haplotype plays an important role in the development of PHN after herpes zoster, but not in the onset of herpes zoster.
15262497 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
15251317 Observational study of genotype prevalence. (HuGE Navigator)
15245541 Observational study of gene-disease association. (HuGE Navigator)
15245377 Observational study of genotype prevalence. (HuGE Navigator)
15245373 Observational study of genotype prevalence. (HuGE Navigator)
15243926 Observational study of gene-disease association. (HuGE Navigator)
15239092 Observational study of gene-disease association. (HuGE Navigator)
15236755 Observational study of gene-disease association. (HuGE Navigator)
15228651 Observational study of gene-disease association. (HuGE Navigator)
15220037 Observational study of gene-disease association. (HuGE Navigator)
15211110 Observational study of gene-disease association. (HuGE Navigator)
15202948 Observational study of gene-disease association. (HuGE Navigator)
15194762 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
15191952 Observational study of gene-disease association. (HuGE Navigator)
15191527 identification of a new variant of the A*2607 allele, named A*260702
15166527 Observational study of gene-disease association. (HuGE Navigator)
15144462 Observational study of gene-disease association. (HuGE Navigator)
15140038 Observational study of genotype prevalence. (HuGE Navigator)
15140031 Observational study of genotype prevalence. (HuGE Navigator)
15131131 Results indicate that mutations at both position 65 and position 66 influence peptide binding by the human class I major histocompatibility complex molecule HLA-A2 to various extents.
15128924 Observational study of gene-disease association. (HuGE Navigator)
15128805 The apparent association of HLA-A*1101 with resistance to HIV-1 infection may reflect, at least in part, an interplay of functional advantages that particular structural features of the peptide-binding groove may confer to HLA-A*1101.
15124939 Observational study of gene-disease association. (HuGE Navigator)
15122136 Observational study of gene-disease association. (HuGE Navigator)
15113995 Observational study of gene-disease association. (HuGE Navigator)
15100263 Novel conditions are required for priming and antigen-specific expansion of cytotoxic T cells reactive to the HIV-1 p17 Gag(77-85) epitope on circulating naive CD8+ precursor cells derived from HLA-A*0201 HIV-seronegative healthy donors.
15086350 Observational study of gene-disease association. (HuGE Navigator)
15078178 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
15072129 Observational study of gene-disease association. (HuGE Navigator)
15072129 Significant increase in frequency of HLA-A were observed in leprosy patients when compared with controls.
15070694 selective down-regulation of HLA-A and HLA-Bw6 allospecificities associated with HLA-Bw4 preservation in leukemic cells
15061705 Observational study of gene-disease association. (HuGE Navigator)
15057902 Observational study of gene-disease association. (HuGE Navigator)
15046556 In patients with autoimmune thyroiditis the HLA-A24 frequency of was higher than control values while in patients with polyglandular activation of autoimmunity, the HLA-A3 frequency was found to be higher.
15034213 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15009808 Observational study of gene-disease association. (HuGE Navigator)
15009803 Observational study of genotype prevalence. (HuGE Navigator)
15009432 Observational study of gene-disease association. (HuGE Navigator)
15000695 Observational study of gene-disease association. (HuGE Navigator)
14989713 Observational study of gene-disease association. (HuGE Navigator)
14969772 Observational study of gene-disease association. (HuGE Navigator)
14969772 HLA-A*2402 together with microsatellite D6S248-15 allele could be B27-independent markers of additional susceptibility gene/s localised in the region telomeric to HLA-A in Basque ankylosing spondylitis patients.
14965316 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
14871250 Observational study of gene-disease association. (HuGE Navigator)
14748996 The frequency of haplotypes HLA-A in systemic lupus erythematosus group was significantly higher than that of control.
14727382 Observational study of gene-disease association. (HuGE Navigator)
14705987 Observational study of genotype prevalence. (HuGE Navigator)
14700599 Observational study of genotype prevalence. (HuGE Navigator)
14700598 Observational study of genotype prevalence. (HuGE Navigator)
14700597 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14700596 Observational study of gene-disease association. (HuGE Navigator)
14693734 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14693734 HLA alleles plays an important role in the development of central nervous system meningiomas.
14686115 Observational study of gene-disease association. (HuGE Navigator)
14674935 Observational study of gene-disease association. (HuGE Navigator)
14673570 Observational study of gene-disease association. (HuGE Navigator)
14656748 Observational study of gene-disease association. (HuGE Navigator)
14651518 Observational study of gene-disease association. (HuGE Navigator)
14648147 Observational study of gene-disease association. (HuGE Navigator)
14617038 Observational study of genotype prevalence. (HuGE Navigator)
14617036 we examine the contribution of the HLA region to the clinical phenotype of UC.
14601650 a novel HLA-A0201-restricted cytotoxic T lymphocyte (CTL)-epitope (28-SLYKFSPFPL; FSP06) derived from a mutant O-linked N-acetylglucosamine transferase
14595379 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
14581545 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14557639 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
14551034 Observational study of gene-disease association. (HuGE Navigator)
14527733 Observational study of gene-disease association. (HuGE Navigator)
14527201 Observational study of genotype prevalence. (HuGE Navigator)
14522093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14510801 Observational study of gene-disease association. (HuGE Navigator)
14504973 Observational study of gene-disease association. (HuGE Navigator)
14501786 Observational study of gene-disease association. (HuGE Navigator)
12975536 Observational study of gene-disease association. (HuGE Navigator)
12974801 Observational study of genotype prevalence. (HuGE Navigator)
12956878 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12956877 Observational study of genotype prevalence. (HuGE Navigator)
12941076 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12917841 Observational study of gene-disease association. (HuGE Navigator)
12884192 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
12866921 Observational study of genotype prevalence. (HuGE Navigator)
12859597 A Gambian TNF haplotype matches the European HLA-A1, B8, DR3 and Chinese HLA-A33, B58, DR3 haplotypes.
12859593 A computational method was used to predict the serologic specificity of HLA molecules encoded by HLA-A.
12850493 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12836198 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
12826378 Observational study of gene-disease association. (HuGE Navigator)
12826374 identified 21 critical polymorphic functional residue positions (CPFRP) that significantly reduced functional pocket variability to just 189 among 212 HLA-A alleles
12825172 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12811505 Observational study of gene-disease association. (HuGE Navigator)
12803653 Observational study of gene-disease association. (HuGE Navigator)
12774051 Observational study of gene-disease association. (HuGE Navigator)
12768083 Familial predisposition to IgA nephropathy is associated with HLA antigens and particular candidate genes.
12753667 Observational study of genotype prevalence. (HuGE Navigator)
12753666 Observational study of genotype prevalence. (HuGE Navigator)
12753657 Observational study of genotype prevalence. (HuGE Navigator)
12734410 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
12717621 Observational study of gene-disease association. (HuGE Navigator)
12714268 Observational study of gene-disease association. (HuGE Navigator)
12694583 Observational study of gene-disease association. (HuGE Navigator)
12694583 HLA-A, -B, and -DRB1 alleles in a total of 236 Taiwanese adults with Graves' disease and 533 racially matched normal control subjects were examined
12691707 Observational study of genotype prevalence. (HuGE Navigator)
12665835 Observational study of gene-disease association. (HuGE Navigator)
12651075 Observational study of gene-disease association. (HuGE Navigator)
12648281 Observational study of genotype prevalence. (HuGE Navigator)
12590984 Observational study of genotype prevalence. (HuGE Navigator)
12584329 results indicate that the most prominent effect of Nef on HLA-A2 in T cells was to inhibit transport to the cell surface
12584329 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
12578601 Observational study of genetic testing. (HuGE Navigator)
12574360 Observational study of gene-disease association. (HuGE Navigator)
12526811 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
12516093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12507828 Observational study of genetic testing. (HuGE Navigator)
12507825 Observational study of genotype prevalence. (HuGE Navigator)
12507823 Observational study of gene-disease association. (HuGE Navigator)
12507820 Observational study of gene-disease association. (HuGE Navigator)
12502873 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
12486606 Observational study of gene-disease association. (HuGE Navigator)
12486530 Observational study of genotype prevalence. (HuGE Navigator)
12482663 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
12472660 HLA-A allele associations with secondary dengue virus infections correlate with disease severity and the infecting viral serotype in ethnic Thais.
12472657 Observational study of genotype prevalence. (HuGE Navigator)
12464650 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12459502 Observational study of gene-disease association. (HuGE Navigator)
12458337 Observational study of gene-disease association. (HuGE Navigator)
12445319 Observational study of genotype prevalence. (HuGE Navigator)
12445318 Observational study of genotype prevalence. (HuGE Navigator)
12445315 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12443029 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12437654 Observational study of gene-disease association. (HuGE Navigator)
12427289 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
12414957 Nef binds directly to the HLA-A2 cytoplasmic tail
12414957 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
12392856 Observational study of gene-disease association. (HuGE Navigator)
12372094 Observational study of gene-disease association. (HuGE Navigator)
12370503 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12370085 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12366790 The allelic product of HLA-B*3531 is composed of B35 in its alpha1 domain and of B61(40) in its alpha2 domain. Both specificities are only weakly detectable with available sera.
12366789 The new allele HLA-B*4431 only displayed B44 seroreactivity, which demonstrates that epitopes crucial for B60(40) specificity must be located in the alpha1 domain.
12366788 HLA-A*6818 N displays a sequence identical to that of the HLA-A*6802 allele. This duplication creates a shift of the reading frame, which leads to a premature non-sense codon at position 59 of the null allele.
12366787 The nucleotide sequences of HLA-A*1112 exons 2 and 3 are identical to HLA-A*11011 except for a single nucleotide substitution in codon 90 (GAC-->GCC).
12351949 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12296785 Observational study of gene-disease association. (HuGE Navigator)
12186703 Observational study of gene-disease association. (HuGE Navigator)
12174215 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12168074 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12145797 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12144620 Observational study of genotype prevalence. (HuGE Navigator)
12121673 The HLA class I A locus affects susceptibility to type 1 diabetes.
12115193 Observational study of gene-disease association. (HuGE Navigator)
12100686 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12100571 Observational study of gene-disease association. (HuGE Navigator)
12097566 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
12077441 a soluble recombinant HLA-A*1101 molecule has been expressed and used to assemble a complex with beta2-microglobulin and a Nef decapeptide.
12047355 Observational study of genotype prevalence. (HuGE Navigator)
12043563 Observational study of genotype prevalence. (HuGE Navigator)
12029127 Polymorphisms in HIV-1 reverse transcriptase were most evident at sites of least functional or structural constraint and frequently were associated with particular host HLA-A and HLA-B alleles
12028542 two new HLA-A alleles, A*2419 and A* 3011, that were initially recognized by an aberrant serological pattern.
12028541 Eight new HLA-A alleles associated with antigens in the A2 CREG.
12010826 Observational study of gene-disease association. (HuGE Navigator)
11984513 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11979305 Observational study of gene-disease association. (HuGE Navigator)
11956863 Observational study of gene-disease association. (HuGE Navigator)
11953475 HLA-A*3303 restricts an HIV-1 Vpu epitope associated with non-progression.
11932387 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
11929590 Observational study of gene-disease association. (HuGE Navigator)
11927505 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11914421 Observational study of gene-disease association. (HuGE Navigator)
11904677 Observational study of genotype prevalence. (HuGE Navigator)
11903375 Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
11887210 Observational study of genotype prevalence and gene-gene interaction. (HuGE Navigator)
11862383 Disparate binding of chaperone proteins by HLA-A subtypes
11861287 Soluble HLA class I molecules induce natural killer cell apoptosis through the engagement of CD8. HLA-A2, -Cw4, and -Bw46 alleles, or HLA-G1 leads to NK cell apoptosis.
11841366 Observational study of gene-disease association. (HuGE Navigator)
11840504 Proposed association of A24 and A26 with schizophrenia in Japan was not confirmed.
11840200 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11752149 magnitude and specificity of influenza A virus-specific cytotoxic T-lymphocyte responses in humans is related to HLA-A and -B phenotype
11751963 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
11737038 Observational study of gene-disease association. (HuGE Navigator)
11678832 Observational study of gene-disease association. (HuGE Navigator)
11602047 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
11600222 Observational study of genotype prevalence. (HuGE Navigator)
11578695 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
11556980 Observational study of genotype prevalence. (HuGE Navigator)
11556970 Observational study of gene-disease association. (HuGE Navigator)
11543903 Observational study of genotype prevalence. (HuGE Navigator)
11543893 Observational study of genotype prevalence. (HuGE Navigator)
11543892 Observational study of genotype prevalence. (HuGE Navigator)
11507979 Observational study of gene-disease association. (HuGE Navigator)
11500821 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
11485622 Observational study of gene-disease association. (HuGE Navigator)
11480844 Observational study of gene-disease association. (HuGE Navigator)
11464148 Observational study of gene-disease association. (HuGE Navigator)
11463741 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
11438519 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
11423179 Observational study of gene-disease association. (HuGE Navigator)
11423176 Observational study of gene-disease association. (HuGE Navigator)
11396948 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
11374682 Observational study of gene-disease association. (HuGE Navigator)
11294566 Observational study of gene-disease association. (HuGE Navigator)
11289809 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
11285128 Observational study of genotype prevalence. (HuGE Navigator)
11285127 Observational study of genotype prevalence. (HuGE Navigator)
11266078 Observational study of gene-environment interaction. (HuGE Navigator)
11260507 Observational study of genotype prevalence. (HuGE Navigator)
11260506 Observational study of genotype prevalence. (HuGE Navigator)
11208333 Observational study of gene-disease association. (HuGE Navigator)
11182232 Observational study of genotype prevalence. (HuGE Navigator)
11182228 Observational study of genotype prevalence. (HuGE Navigator)
11181188 Observational study of gene-disease association. (HuGE Navigator)
11180452 Observational study of gene-disease association. (HuGE Navigator)
11169245 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11169242 Observational study of genotype prevalence. (HuGE Navigator)
11169240 Observational study of genotype prevalence. (HuGE Navigator)
11144289 Observational study of genotype prevalence. (HuGE Navigator)
11133384 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11120862 Observational study of gene-disease association. (HuGE Navigator)
11119299 Observational study of genotype prevalence. (HuGE Navigator)
11118029 Observational study of gene-disease association. (HuGE Navigator)
11098929 Observational study of genotype prevalence. (HuGE Navigator)
11082518 Observational study of genotype prevalence. (HuGE Navigator)
11064107 Observational study of gene-disease association. (HuGE Navigator)
11053636 Observational study of gene-environment interaction. (HuGE Navigator)
11010837 Observational study of gene-disease association. (HuGE Navigator)
10982373 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
10954160 Observational study of genotype prevalence. (HuGE Navigator)
10799863 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
10707087 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
10684310 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
10546855 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
10403641 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
10366557 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
9971776 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
9840288 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
9751712 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
9586638 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
9582271 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
9373217 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
9263011 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
9123874 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
9120272 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
9104816 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
9052838 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
8877415 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
8671651 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
8612235 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
8493575 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
8084338 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
7913356 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
7621073 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
7539755 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
2789433 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes
1316930 HIV-1 Nef interacts with HLA-A (MHC1) and this interaction occurs partially within RAB5+ early endosomes

AA Sequence

MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKME      1 - 70
PRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQD     71 - 140
AYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGTCVEWLRRYLENGKETLQRTDPPK    141 - 210
THMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASS    281 - 350
DSAQGSDVSLTACKV                                                           351 - 365
//

Text Mined References (1184)

PMID Year Title
26974162 2016 Promiscuous Recognition of a Trypanosoma cruzi CD8+ T Cell Epitope among HLA-A2, HLA-A24 and HLA-A1 Supertypes in Chagasic Patients.
26967484 2016 The HLA Alleles B*0801 and DRB1*0301 Are Associated with Dermatitis Herpetiformis in a Chinese Population.
26787886 2016 Autoimmune vitiligo is associated with gain-of-function by a transcriptional regulator that elevates expression of HLA-A*02:01 in vivo.
26656886 2016 Potential protective effect of a G>A SNP in the 3'UTR of HLA-A for Chlamydia trachomatis symptomatology and severity of infection.
26621839 2016 A HLA-A2-restricted CTL epitope induces anti-tumor effects against human lung cancer in mouse xenograft model.
26600404 2016 Clusters of Structurally Similar MHC I HLA-A2 Molecules, Found with a New Method, Suggest Mechanisms of T-Cell Receptor Avidity.
26564811 2016 HLA class I downregulation is associated with enhanced NK-cell killing of melanoma cells with acquired drug resistance to BRAF inhibitors.
26507656 2015 The T210M Substitution in the HLA-a*02:01 gp100 Epitope Strongly Affects Overall Proteasomal Cleavage Site Usage and Antigen Processing.
26490229 2015 Development of a simple genotyping method for the HLA-A*31:01-tagging SNP in Japanese.
26448174 2015 Genetic Predisposition to Stevens-Johnson Syndrome With Severe Ocular Surface Complications.
26422112 2016 The impact of HLA class I and EBV latency-II antigen-specific CD8(+) T cells on the pathogenesis of EBV(+) Hodgkin lymphoma.
26375851 2015 Comprehensive Analysis of the Naturally Processed Peptide Repertoire: Differences between HLA-A and B in the Immunopeptidome.
26345971 2015 HLA-A gene polymorphisms contribute to osteoporosis susceptibility in postmenopausal Han Chinese women.
26331842 2015 Molecular Dynamics Simulation Reveals the Selective Binding of Human Leukocyte Antigen Alleles Associated with Behçet's Disease.
26310460 2015 Effect of Chronic Uremia on the Cell Surface Expression of B7 Family Costimulatory Molecules in an HLA-A2 Transgenic Mouse Model of Chronic Kidney Disease.
26258424 2015 Cell surface expression level variation between two common Human Leukocyte Antigen alleles, HLA-A2 and HLA-B8, is dependent on the structure of the C terminal part of the alpha 2 and the alpha 3 domains.
26199258 2015 Relationships of Human Leukocyte Antigen-A, -B, -DRB1 Alleles, and Haplotypes in 129 Ethnic Turkish Patients With Acute Myeloblastic Leukemia.
26083016 2015 Accuracy of SNPs to predict risk of HLA alleles associated with drug-induced hypersensitivity events across racial groups.
26057149 2015 Epstein-Barr virus latent membrane protein 2A mediated activation of Sonic Hedgehog pathway induces HLA class Ia downregulation in gastric cancer cells.
26037364 2015 [Identification of 3 novel HLA-A alleles A*24:224, A*24:225 and A*24:257 by sequence-based typing].
25972545 2015 Respiratory Syncytial Virus Infection Upregulates NLRC5 and Major Histocompatibility Complex Class I Expression through RIG-I Induction in Airway Epithelial Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25940993 2015 Sequence-based typing of HLA-A gene in 930 patients with nasopharyngeal carcinoma in Hunan province, southern China.
25940109 2015 On the genetics of the Silk Route: association analysis of HLA, IL10, and IL23R-IL12RB2 regions with Behçet's disease in an Iranian population.
25935001 2015 Epigenetic regulation of differential HLA-A allelic expression levels.
25754738 2015 Relative expression levels of the HLA class-I proteins in normal and HIV-infected cells.
25666956 2015 DNA typing of HLA-A, -C, -B, AND -DRB1 in the children with autism in the Republic of Macedonia.
25666200 2015 The host HLA-A*02 allele is associated with the response to pegylated interferon and ribavirin in patients with chronic hepatitis C virus infection.
25659158 2015 HLA-A*33:01 as protective allele for severe dengue in a population of Filipino children.
25645285 2015 Major association of vitiligo with HLA-A*02:01 in Japanese.
25631937 2015 Human CD8 T lymphocytes recognize Mycobacterium tuberculosis antigens presented by HLA-E during active tuberculosis and express type 2 cytokines.
25626601 2015 Polymorphisms of HLA-A, -B, -Cw and DRB1 antigens in Moroccan patients with ankylosing spondylitis and a comparison of clinical features with frequencies of HLA-B*27.
25617474 2015 HLA-A02:01-restricted epitopes identified from the herpes simplex virus tegument protein VP11/12 preferentially recall polyfunctional effector memory CD8+ T cells from seropositive asymptomatic individuals and protect humanized HLA-A*02:01 transgenic mice against ocular herpes.
25549594 2014 HLA-A*26 and susceptility of iranian patients with non-Hodgkin lymphoma.
25515742 2015 Different patterns of A*80:01:01:01 allele generation based on exon or intron sequences.
25495410 2014 HLA-A*02:01:01/-B*35:01:01/-C*04:01:01 haplotype associated with lamotrigine-induced maculopapular exanthema in Mexican Mestizo patients.
25469587 2015 Interaction of TLR-IFN and HLA polymorphisms on susceptibility of chronic HBV infection in Southwest Han Chinese.
25413106 2014 Nonfrequent but well-documented, rare and very rare HLA alleles observed in the Croatian population.
25355886 2015 Varicella-zoster virus-derived major histocompatibility complex class I-restricted peptide affinity is a determining factor in the HLA risk profile for the development of postherpetic neuralgia.
25352173 2014 The HLA-A*68:23 allele in the Chilean population.
25330014 2014 Time to seroconversion in HIV-exposed subjects carrying protective versus non protective KIR3DS1/L1 and HLA-B genotypes.
25324153 2014 Interaction between passive smoking and two HLA genes with regard to multiple sclerosis risk.
25295286 2014 Comparisons of CVID and IgGSD: referring physicians, autoimmune conditions, pneumovax reactivity, immunoglobulin levels, blood lymphocyte subsets, and HLA-A and -B typing in 432 adult index patients.
25244652 2014 Unrelated donor HLA re-typing effort to verify prevalence of newer alleles: HLA-A*24:23, A*30:10, DRB1*08:11, DRB1*15:03, and DRB1*15:06.
25243920 2014 Human herpesvirus 6B immediate-early I protein contains functional HLA-A*02, HLA-A*03, and HLA-B*07 class I restricted CD8(+) T-cell epitopes.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25197660 2014 Alzheimer's disease and HLA-A2: linking neurodegenerative to immune processes through an in silico approach.
25193656 2014 Nef-mediated down-regulation of CD4 and HLA class I in HIV-1 subtype C infection: association with disease progression and influence of immune pressure.
25187890 2014 Absence of HLA-B*1502 and HLA-A*3101 alleles in 9 Korean patients with antiepileptic drug-induced skin rash: a preliminary study.
25099678 2014 Trans-ethnic study confirmed independent associations of HLA-A*02:06 and HLA-B*44:03 with cold medicine-related Stevens-Johnson syndrome with severe ocular surface complications.
24990997 2014 The immunodominant influenza A virus M158-66 cytotoxic T lymphocyte epitope exhibits degenerate class I major histocompatibility complex restriction in humans.
24963477 2014 The association of HLA-class I and class II with Hodgkin's lymphoma in Iranian patients.
24947555 2015 HLA-A SNPs and amino acid variants are associated with nasopharyngeal carcinoma in Malaysian Chinese.
24781922 2014 Independent strong association of HLA-A*02:06 and HLA-B*44:03 with cold medicine-related Stevens-Johnson syndrome with severe mucosal involvement.
24737799 2014 HLA and killer cell immunoglobulin-like receptors influence the natural course of CMV infection.
24717292 2014 Impact of donor mismatches at individual HLA-A, -B, -C, -DR, and -DQ loci on the development of HLA-specific antibodies in patients listed for repeat renal transplantation.
24691290 2014 An analysis of HLA-A, -B, and -DRB1 allele and haplotype frequencies of 21,918 residents living in Liaoning, China.
24681846 2014 Development of a T cell receptor targeting an HLA-A*0201 restricted epitope from the cancer-testis antigen SSX2 for adoptive immunotherapy of cancer.
24662416 2014 HLA-A(?)02, gender and tobacco smoking, but not multiple sclerosis, affects the IgG antibody response against human herpesvirus 6.
24643698 2014 The WT hemochromatosis protein HFE inhibits CD8? T-lymphocyte activation.
24597466 2014 Recommendations for HLA-B*15:02 and HLA-A*31:01 genetic testing to reduce the risk of carbamazepine-induced hypersensitivity reactions.
24554773 2014 NK cell killer Ig-like receptor repertoire acquisition and maturation are strongly modulated by HLA class I molecules.
24553509 HLA-A*31 as a marker of genetic susceptibility to sepsis.
24550293 2014 Activating killer cell immunoglobulin-like receptor 2DS2 binds to HLA-A*11.
24500647 2014 Interaction between adolescent obesity and HLA risk genes in the etiology of multiple sclerosis.
24490781 2014 Human leucocyte antigen frequency in a miscegenated population presenting with seborrhoeic dermatitis.
24476427 2014 HLA restriction of carbamazepine-specific T-Cell clones from an HLA-A*31:01-positive hypersensitive patient.
24389314 2014 Association analysis between HLA-A, -B, -C, -DRB1, and -DQB1 with nasopharyngeal carcinoma among a Han population in Northwestern China.
24375541 2014 Identification of novel human leukocyte antigen-A*0201-restricted, cytotoxic T lymphocyte epitopes on CD133 for cancer stem cell immunotherapy.
24336023 2014 HLA alleles and hypersensitivity to carbamazepine: an updated systematic review with meta-analysis.
24324503 2013 Association of human leukocyte antigen class I polymorphism with spontaneous clearance of hepatitis B surface antigen in Qidong Han population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269699 2014 Frequency analysis of HLA class I alleles in Iranian patients with progressive and non-progressive chronic lymphocytic leukemia.
24248811 2014 Association and differentiation of MHC class I and II polymorphic Alu insertions and HLA-A, -B, -C and -DRB1 alleles in the Chinese Han population.
24244023 2013 The MAPK pathway is a predominant regulator of HLA-A expression in esophageal and gastric cancer.
24223798 2013 EGFR T790M mutation as a possible target for immunotherapy; identification of HLA-A*0201-restricted T cell epitopes derived from the EGFR T790M mutation.
24084328 2013 HLA-A2, HLA-B44 and HLA-DR15 are associated with lower risk of BK viremia.
24046013 2013 High-resolution HLA matching in hematopoietic stem cell transplantation: a retrospective collaborative analysis.
24033735 2013 The role of the human leukocyte antigen system in retinopathy of prematurity: a pilot study.
23994122 2014 Distribution of HLA-A, B and DRB1 alleles in Sahariya tribe of North Central India: an association with pulmonary tuberculosis.
23963968 2013 Characterization of the human CD4(+) T-cell repertoire specific for major histocompatibility class I-restricted antigens.
23953521 HLA-A, -B, -DRB1 allele and haplotype frequencies and comparison with blood group antigens in dialysis patients in the East Anatolia region of Turkey.
23911395 2013 Identification of a novel HLA-A*24:02-restricted adenovirus serotype 11-specific CD8+ T-cell epitope for adoptive immunotherapy.
23836912 2013 Peptide modulation of class I major histocompatibility complex protein molecular flexibility and the implications for immune recognition.
23724919 2013 HLA-A, -B and -DRB1 polymorphism in Koreans defined by sequence-based typing of 4128 cord blood units.
23638805 2013 Association between HLA genes and American cutaneous leishmaniasis in endemic regions of Southern Brazil.
23588310 2013 HLA-A 31:01 and HLA-B 15:02 as genetic markers for carbamazepine hypersensitivity in children.
23566939 2013 Structural basis for the differential classification of HLA-A*6802 and HLA-A*6801 into the A2 and A3 supertypes.
23417110 2013 Genome-wide association study identified the human leukocyte antigen region as a novel locus for plasma beta-2 microglobulin.
23401559 2013 Tapasin-related protein TAPBPR is an additional component of the MHC class I presentation pathway.
23349864 2013 Separate developmental programs for HLA-A and -B cell surface expression during differentiation from embryonic stem cells to lymphocytes, adipocytes and osteoblasts.
23330836 2013 Association of human leukocyte antigen class I antigens in Iranian patients with pemphigus vulgaris.
23246585 2013 Filling the gaps - the generation of full genomic sequences for 15 common and well-documented HLA class I alleles using next-generation sequencing technology.
23237922 2013 Risk factors for sorafenib-induced high-grade skin rash in Japanese patients with advanced renal cell carcinoma.
23220495 2013 Differing HLA types influence inhibitory receptor signalling in CMV-specific CD8+ T cells.
23200758 2013 High-resolution HLA haplotype frequencies of stem cell donors in Germany with foreign parentage: how can they be used to improve unrelated donor searches?
23178241 2013 Diagnostic utility of HFE variants in Spanish patients: association with HLA alleles and role in susceptibility to acute lymphoblastic leukemia.
23176610 2013 Linkage disequilibrium between TNF-?-308 G/A promoter and histocompatibility leukocyte antigen alleles in Han-nationality lung transplant recipients from Eastern China.
23160529 2013 HLA-A*24 is an independent predictor of 5-year progression to diabetes in autoantibody-positive first-degree relatives of type 1 diabetic patients.
23107309 2013 A conserved HLA-A*02:28 associated HLA haplotype, A*02:28-B*15:11-DRB1*09:01, restricted to Taiwanese.
23083632 2013 Paradoxical downregulation of HLA-A expression by IFN? associated with schizophrenia and noncoding genes.
23028341 2012 Genome-wide association study for serum complement C3 and C4 levels in healthy Chinese subjects.
23019373 2012 T cells engineered with a T cell receptor against the prostate antigen TARP specifically kill HLA-A2+ prostate and breast cancer cells.
22981956 2013 [Susceptibility genes, HLA and diabetic retinopathy in the Algerian population].
22972181 2013 HLA-A2 phenotype may be protective against Graves' disease but not against Hashimoto's thyroiditis in Caucasians.
22925811 2013 Susceptibility to chronic hepatitis C virus infection is influenced by sequence differences in immunodominant CD8+ T cell epitopes.
22923333 2012 Molecular architecture of the MHC I peptide-loading complex: one tapasin molecule is essential and sufficient for antigen processing.
22912896 2012 HLA-A*0206 with TLR3 polymorphisms exerts more than additive effects in Stevens-Johnson syndrome with severe ocular surface complications.
22898188 2013 Alternative peptide repertoire of HLA-E reveals a binding motif that is strikingly similar to HLA-A2.
22887846 2013 HLA-A*31:01 and methotrexate-induced interstitial lung disease in Japanese rheumatoid arthritis patients: a multidrug hypersensitivity marker?
22880099 2012 Evaluation of human leukocyte antigen-A (HLA-A), other non-HLA markers on chromosome 6p21 and risk of nasopharyngeal carcinoma.
22826228 2012 HLA-B may be more protective against HIV-1 than HLA-A because it resists negative regulatory factor (Nef) mediated down-regulation.
22819798 2012 Weak binder for MHC molecule is a potent Mycobacterium tuberculosis-specific CTL epitope in the context of HLA-A24 allele.
22818666 2013 HLA class I protective alleles in an HIV-1-infected subject homozygous for CCR5-?32/?32.
22814293 2013 Risk of developing chronic lymphocytic leukemia is influenced by HLA-A class I variation.
22808081 2012 HLA associations in classical Hodgkin lymphoma: EBV status matters.
22784404 2012 HLA-A and HLA-B gene polymorphism and idiopathic pulmonary fibrosis in a Han Chinese population.
22774598 2012 [HLA-class I gene polymorphisms in Japanese Stevens-Johnson syndrome patients with ocular surface complications].
22723329 2012 Presence of strong association of the major histocompatibility complex (MHC) class I allele HLA-A*26:01 with idiopathic hypoparathyroidism.
22664032 2012 Generation of donor-specific anti-human leukocyte antigen antibodies after the transplantation of a fully matched kidney allograft and its impact on the selection of a subsequent renal regraft: a case report.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22573115 2012 Possible KIR-driven genetic pressure on the genesis and maintenance of specific HLA-A,B haplotypes as functional genetic blocks.
22544926 2012 Two preferentially expressed proteins protect vascular endothelial cells from an attack by peptide-specific CTL.
22531911 2012 Melanoma cells present high levels of HLA-A2-tyrosinase in association with instability and aberrant intracellular processing of tyrosinase.
22513782 2012 A promiscuous survivin-derived T-cell epitope restricted to the HLA-A3 super-type alleles.
22504415 2012 HLA-A and HLA-DRB1 amino acid polymorphisms are associated with susceptibility and protection to pulmonary tuberculosis in a Greek population.
22492182 2012 Computational prediction and experimental assessment of an HLA-A*0201-restricted cytotoxic T lymphocyte epitope from neutral endopeptidase.
22489945 2012 Somatic mutations in the HLA genes of patients with hematological malignancy.
22489943 2012 Closing the gap: discrimination of the expression profile of HLA questionable alleles by a cytokine-induced secretion approach using HLA-A*32:11Q.
22487840 2012 [Analysis of HLA-A, B, and DRB1 polymorphism and genetic distance in Han population living in Yantai and Weihai regions of Shandong province].
22480777 2012 Identification of HLA-A*0201-restricted CD8+ T-cell epitope C????? from hepatitis B virus core protein.
22466790 2012 Posttransplant major histocompatibility complex class I chain-related gene A antibodies and long-term graft outcomes in a multicenter cohort of 779 kidney transplant recipients.
22440091 2012 Further evidence for the existence of major susceptibility of nasopharyngeal carcinoma in the region near HLA-A locus in Southern Chinese.
22424782 2012 Secreted HLA recapitulates the immunopeptidome and allows in-depth coverage of HLA A*02:01 ligands.
22415262 2012 HLA-A*01 allele: a risk factor for dengue haemorrhagic fever in Brazil's population.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22402439 2012 Next-generation DNA re-sequencing identifies common variants of TYR and HLA-A that modulate the risk of generalized vitiligo via antigen presentation.
22379998 2012 Genome-wide mapping for clinically relevant predictors of lamotrigine- and phenytoin-induced hypersensitivity reactions.
22370889 2012 Association between HLA-A and -B polymorphisms and susceptibility to Henoch-Schönlein purpura in Han and Mongolian children from Inner Mongolia.
22355400 2012 HLA-A*02:07 is a protective allele for EBV negative and a susceptibility allele for EBV positive classical Hodgkin lymphoma in China.
22321387 2012 HLA molecules and nasal carriage of Staphylococcus aureus isolated from dialysis and kidney transplant patients at a hospital in Southern Brazil.
22310618 2012 The correlation of HLA allele frequencies and HLA antibodies in sensitized kidney transplantation candidates.
22293801 2012 Differential association between HLA and diffuse panbronchiolitis in Northern and Southern Chinese.
22291187 2012 HLA anchor optimization of the melan-A-HLA-A2 epitope within a long peptide is required for efficient cross-priming of human tumor-reactive T cells.
22258792 2012 Correlation of HLA-A02* genotype and HLA class I antigen down-regulation with the prognosis of epithelial ovarian cancer.
22234791 2012 Analysis of human leucocyte antigen genes in Caucasian patients with idiopathic moyamoya angiopathy.
22221707 2012 Identification of two novel HLA-A*02 variants, A*02:319 and A*02:01:64, in two Taiwanese marrow stem cell donors by sequence-based typing.
22211527 2012 HLA-A31 strongly associates with carbamazepine-induced adverse drug reactions but not with carbamazepine-induced lymphocyte proliferation in a Japanese population.
22197929 2011 A genome-wide association study in Han Chinese identifies multiple susceptibility loci for IgA nephropathy.
22129495 2012 Influence of human leukocyte antigen mismatching on rejection development and allograft survival in liver transplantation: is the relevance of HLA-A locus matching being underestimated?
22110587 2011 An MSI tumor specific frameshift mutation in a coding microsatellite of MSH3 encodes for HLA-A0201-restricted CD8+ cytotoxic T cell epitopes.
22075330 2012 A genome-wide association study of plasma total IgE concentrations in the Framingham Heart Study.
22074999 2012 Human leukocyte antigen class I (A, B, C) and II (DRB1) diversity in the black and Caucasian South African population.
22074997 2012 Identification of HLA-A24-restricted CD8(+) cytotoxic T-cell epitopes derived from mammaglobin-A, a human breast cancer-associated antigen.
22057263 2012 A retrospective review of 15 patients with familial myasthenia gravis over a period of 25 years.
22034849 2012 HLA-A*33:25, a novel allele identified by sequence-based typing, is a well-documented allele in Koreans.
22031944 2012 Multiple viral ligands naturally presented by different class I molecules in transporter antigen processing-deficient vaccinia virus-infected cells.
21963603 2011 Frequent loss of HLA alleles associated with copy number-neutral 6pLOH in acquired aplastic anemia.
21947186 2012 Down-regulation of HLA-A mRNA in peripheral blood mononuclear cell of colorectal cancer.
21943705 2011 Structural basis of cross-allele presentation by HLA-A*0301 and HLA-A*1101 revealed by two HIV-derived peptide complexes.
21929573 2011 Frequency of HLA-A, -B and -DRB1 specificities and haplotypic associations in the population of Castilla y León (northwest-central Spain).
21858133 2011 Disparate associations of HLA class I markers with HIV-1 acquisition and control of viremia in an African population.
21851420 2011 Association of polycystic ovarian syndrome with human leukocyte antigen polymorphism in Korean women.
21833019 2012 HLA alleles and amino-acid signatures of the peptide-binding pockets of HLA molecules in vitiligo.
21816002 2011 Distribution of human leucocyte antigen-A, -B and -DR alleles and haplotypes at high resolution in the population from Jiangsu province of China.
21806781 2011 Oriental HLA-A*11:90 detected in a Taiwanese cord blood sample and the haplotype in association with A*11:90 allele.
21732917 2011 Characterization of 236 novel alleles at the HLA-A, -B, -C, -DRB1, -DQB1 and -DPB1 loci from China Marrow Donor Program.
21712058 2012 Common and well-documented (CWD) alleles of human leukocyte antigen-A, -B, -C, -DRB1, and -DQB1 loci for the Chinese Han population do not quite correlate with the ASHI CWD alleles.
21710262 2012 Identification of a novel HLA-A2-restricted cytotoxic T lymphocyte epitope from cancer-testis antigen PLAC1 in breast cancer.
21705623 2011 ML1419c peptide immunization induces Mycobacterium leprae-specific HLA-A*0201-restricted CTL in vivo with potential to kill live mycobacteria.
21692992 2011 Detection of two HLA-A alleles, A*31:30 and A*26:20, in two Taiwanese volunteer bone marrow donors by sequence-based typing.
21692558 2011 Identification and functional studies of HLA-A0201 restricted CTL epitopes in the X protein of hepatitis B virus.
21690332 2011 Variable NK cell receptors exemplified by human KIR3DL1/S1.
21677135 2011 Anti-CD8 antibodies can trigger CD8+ T cell effector function in the absence of TCR engagement and improve peptide-MHCI tetramer staining.
21670772 2011 Importance of host genetic factors HLA and IL28B as predictors of response to pegylated interferon and ribavirin.
21659045 Polymorphism of human leukocyte antigen-A, -B, and -DRB1 in a Moroccan population from Casablanca: study of the allelic and the haplotypic frequencies.
21645925 2011 Plasticity of human CD8?? binding to peptide-HLA-A*2402.
21644228 2011 [Cloning and sequencing analysis of a novel allele HLA-A*02:251].
21570397 2011 Susceptibility to amoxicillin-clavulanate-induced liver injury is influenced by multiple HLA class I and II alleles.
21551190 2011 Molecular footprints reveal the impact of the protective HLA-A*03 allele in hepatitis C virus infection.
21543847 2011 Structure of HLA-A*0301 in complex with a peptide of proteolipid protein: insights into the role of HLA-A alleles in susceptibility to multiple sclerosis.
21538979 2011 Structural insights into the binding of hepatitis B virus core peptide to HLA-A2 alleles: towards designing better vaccines.
21518758 2011 Tapasin discriminates peptide-human leukocyte antigen-A*02:01 complexes formed with natural ligands.
21515791 2011 An HLA-presented fragment of macrophage migration inhibitory factor is a therapeutic target for invasive breast cancer.
21498667 2011 HLA-A*7401-mediated control of HIV viremia is independent of its linkage disequilibrium with HLA-B*5703.
21459456 2011 Study of HLA Class I gene in Indian schizophrenic patients of Siliguri, West Bengal.
21447147 2011 Characterization of three new alleles HLA-A*02:241, HLA-A*02:242 and HLA-A*30:04:02.
21429233 2011 Associations between the HLA-A polymorphism and the clinical manifestations of Behcet's disease.
21428769 2011 HLA-A*3101 and carbamazepine-induced hypersensitivity reactions in Europeans.
21422676 2011 Relationship between primary nodal generalized osteoarthritis with tissue antigens HLA-A and HLA-B in the western Black Sea region of Turkey.
21417892 2010 HLA genes in populations of the Aleutian islands.
21362330 2011 Association of defective HLA-I expression with antigen processing machinery and their association with clinicopathological characteristics in Kazak patients with esophageal cancer.
21362146 2011 Identification of a novel HLA-A allele, A*11:60, in a Taiwanese family.
21352198 2011 Association of CD8+ T cell infiltration in oesophageal carcinoma lesions with human leucocyte antigen (HLA) class I antigen expression and survival.
21342137 2011 HLA association in SLE patients from Lahore-Pakistan.
21303861 2011 Smoking and two human leukocyte antigen genes interact to increase the risk for multiple sclerosis.
21282516 2011 Conformational melding permits a conserved binding geometry in TCR recognition of foreign and self molecular mimics.
21282510 2011 Naive T cell repertoire skewing in HLA-A2 individuals by a specialized rearrangement mechanism results in public memory clonotypes.
21270202 2011 Clinical and genetic characteristics of patients with type 1 diabetes associated with interferon therapy.
21269460 2011 Initial characterization of the human central proteome.
21209113 2011 Transcription of preintegrated HIV-1 cDNA modulates cell surface expression of major histocompatibility complex class I via Nef.
21179106 2011 Association of HLA-A*02:06 and HLA-DRB1*04:05 with clinical subtypes of juvenile idiopathic arthritis.
21165574 2011 Identification of HLA-A*0201/-A*2402-restricted CTL epitope-peptides derived from a novel cancer/testis antigen, MCAK, and induction of a specific antitumor immune response.
21149285 2011 Genome-wide association study identifies HLA-A*3101 allele as a genetic risk factor for carbamazepine-induced cutaneous adverse drug reactions in Japanese population.
21108609 2010 The relationship between human leukocyte antigens (HLA) and renal cell carcinoma.
21105039 2011 T cells reactive with HLA-A*0201 peptides from the histone demethylase JARID1B are found in the circulation of breast cancer patients.
21089677 2010 [Association of HLA-A0205 and HLA-A30 with latent autoimmune diabetes in adults].
21087485 2010 HLA polymorphisms and detection of kaposi sarcoma-associated herpesvirus DNA in saliva and peripheral blood among children and their mothers in the uganda sickle cell anemia KSHV Study.
21079793 2010 Allele polymorphism and haplotype diversity of HLA-A, -B and -DRB1 loci in sequence-based typing for Chinese Uyghur ethnic group.
21059899 2011 MHC variation and risk of childhood B-cell precursor acute lymphoblastic leukemia.
21058939 2010 A novel allele, HLA-A*11:01:10, identified by sequence-based typing in a Chinese individual.
21049023 2010 A polymorphism in the HLA-DPB1 gene is associated with susceptibility to multiple sclerosis.
21040492 2011 An HLA-A*02:01-B*13:01-DRB1*14:01:03 haplotype conserved in Taiwanese and a possible close relationship between DRB1*14:01:03 and DRB1*14:54.
21029668 2010 [Influence of HLA-A, B loci carrying Bw4 motif on HIV CD4 T cell count and viral load].
20974205 2011 Human leukocyte antigen-A, -B, -C, -DRB1 allele and haplotype frequencies in Americans originating from southern Europe: contrasting patterns of population differentiation between Italian and Spanish Americans.
20970669 2010 Association of HLA haplotypes with paroxysmal nocturnal hemoglobinuria.
20946353 2011 Receptor-mediated ER export of human MHC class I molecules is regulated by the C-terminal single amino acid.
20937338 2011 HLA-A, -B, -C, -DQB1, and -DRB1,3,4,5 allele and haplotype frequencies in the Costa Rica Central Valley Population and its relationship to worldwide populations.
20931685 2010 Human leukocyte antigen (HLA) and single nucleotide polymorphisms (SNPs) tumor necrosis factor (TNF)-alpha -238 and -308 as genetic markers of susceptibility to psoriasis and severity of the disease in a long-term follow-up Brazilian study.
20927388 2010 Susceptible and protective HLA class 1 alleles against dengue fever and dengue hemorrhagic fever patients in a Malaysian population.
20923372 2010 Class I HLA-A*7401 is associated with protection from HIV-1 acquisition and disease progression in Mbeya, Tanzania.
20923327 2011 HLA genes in Wayu Amerindians from Colombia.
20868569 Genetic association of HLA-A*2601 with ocular Behçet's disease in Japanese patients.
20858522 2010 Inactivation of a functional HLA-A gene: a 4-kb deletion turns HLA-A*24 into a pseudogene.
20851016 2010 Absence of consistent association between human leukocyte antigen-I and -II alleles and human T-lymphotropic virus type 1 (HTLV-1)-associated myelopathy/tropical spastic paraparesis risk in an HTLV-1 French Afro-Caribbean population.
20844028 2010 Novel immunodominant peptide presentation strategy: a featured HLA-A*2402-restricted cytotoxic T-lymphocyte epitope stabilized by intrachain hydrogen bonds from severe acute respiratory syndrome coronavirus nucleocapsid protein.
20813390 2010 HPV-16 E5 down-regulates expression of surface HLA class I and reduces recognition by CD8 T cells.
20812845 2010 Maternal human leukocyte antigen A*2301 is associated with increased mother-to-child HIV-1 transmission.
20800922 2010 HLA class I allele associations with HCV genetic variants in patients with chronic HCV genotypes 1a or 1b infection.
20798335 2010 HLA class I and genetic susceptibility to type 1 diabetes: results from the Type 1 Diabetes Genetics Consortium.
20739684 2010 Effect of HLA class I and class II alleles on progression from autoantibody positivity to overt type 1 diabetes in children with risk-associated class II genotypes.
20736246 2010 Infectious mononucleosis-linked HLA class I single nucleotide polymorphism is associated with multiple sclerosis.
20723328 2010 [Associations of human leukocyte antigen-A, B, DRB1 genes with leukemia patients in Anhui province of China].
20722701 2010 Longer survival associated with HLA-A*03, B*14 among 212 hemochromatosis probands with HFE C282Y homozygosity and HLA-A and -B typing and haplotyping.
20715101 2011 T cell recognition of HLA-A2 restricted tumor antigens is impaired by the oncogene HER2.
20713950 2010 HLA B*44: protective effects in MS susceptibility and MRI outcome measures.
20707881 2010 Polymorphism between HLA-A*0301 and A*0302 located outside the pocket F alters the P? peptide motif.
20692483 Role of major histocompatibility complex and ethnicity in acute renal graft rejection.
20684489 2010 Genetic aspect of venom allergy: association with HLA class I and class II antigens.
20679961 2010 Development of new HLA-B*3505 genotyping method using Invader assay.
20678810 2010 Two HLA class I genes independently associated with multiple sclerosis.
20670332 2011 HLA polymorphism in a Guarani-Indian population from Paraguay and its usefulness for the Hispano-Indian admixture study in Paraguay.
20668555 2010 Extended LTA, TNF, LST1 and HLA gene haplotypes and their association with rubella vaccine-induced immunity.
20666704 2011 HLA class I and class II polymorphisms in Tunisian Berbers.
20660184 2010 Additive contribution of HLA class I alleles in the immune control of HIV-1 infection.
20650849 2010 [Cloning and sequencing HLA-A and -B genomic DNA and analyzing polymorphism in regulatory regions in Chinese Han individuals].
20637045 2010 Genetic link among Hani, Bulang and other Southeast Asian populations: evidence from HLA -A, -B, -C, -DRB1 genes and haplotypes distribution.
20631027 2010 Haplotype analysis discriminates genetic risk for DR3-associated endocrine autoimmunity and helps define extreme risk for Addison's disease.
20619457 2010 Structures of native and affinity-enhanced WT1 epitopes bound to HLA-A*0201: implications for WT1-based cancer therapeutics.
20613458 2010 Association between HLA inheritance and asthma medication use in HIV positive children.
20610889 2010 Enhanced susceptibility of HLA-mediated ticlopidine-induced idiosyncratic hepatotoxicity by CYP2B6 polymorphism in Japanese.
20608062 2010 [Class 1 and 2 HLA in coeliacia patients in Belarus].
20600449 2010 Origins and relatedness of human leukocyte antigen class I allele supertypes.
20600444 2010 Human leukocyte antigen-A, -B, and -DRB1 allele and haplotype frequencies in the Mozambican population: a blood donor-based population study.
20600442 2010 Associations between genes for killer immunoglobulin-like receptors and their ligands in patients with solid tumors.
20595243 2010 HLA genotyping in the international Type 1 Diabetes Genetics Consortium.
20567513 2010 HLA-associated immune pressure on Gag protein in CRF01_AE-infected individuals and its association with plasma viral load.
20559009 2010 HLA status in patients with chronic spontaneous urticaria.
20550778 2010 Human leukocyte antigen typing in tuberculous rheumatism: Poncet's disease.
20549830 2010 Correlation of molecular human leukocyte antigen typing and outcome in high-risk melanoma patients receiving adjuvant interferon.
20548248 2010 Correlation between HLA alleles and EGFR mutation in Japanese patients with adenocarcinoma of the lung.
20547426 2010 HLA-DQ2+ individuals are susceptible to Hu-Ab associated paraneoplastic neurological syndromes.
20537664 2010 [Clinical and epidemiological features and HLA association in patients with pars planitis].
20536993 2010 HLA genotype in patients with acquired haemophilia A.
20536911 2010 Impact of amino acid substitution at residue 9 of HLA-A2 on the development of acute GVHD in Korean pediatric patients receiving unrelated hematopoietic stem cell transplantation.
20519398 2010 Influence of HLA class I and HLA-KIR compound genotypes on HIV-2 infection and markers of disease progression in a Manjako community in West Africa.
20518846 2010 HLA polymorphisms in Sindhi community in Mumbai, India.
20518845 2010 Distribution of human leukocyte antigen alleles and haplotypes in Oroqen and Ewenki nationality minority in Inner Mongolia Autonomous Region of China.
20512145 2010 A genome-wide association study of nasopharyngeal carcinoma identifies three new susceptibility loci.
20504258 2010 HLA-B*5901 is strongly associated with methazolamide-induced Stevens-Johnson syndrome/toxic epidermal necrolysis.
20501960 2010 HLA-A alleles and the risk of cervical squamous cell carcinoma in Japanese women.
20493227 2010 Distributions of human leukocyte antigen-A, -B, and -DRB1 alleles and haplotypes based on 46,915 Taiwanese donors.
20492599 2010 Correlation between genetic HLA class I and II polymorphisms and anthropological aspects in the Chaouya population from Morocco (Arabic speaking).
20492597 2010 An influence of HLA-A, B, DR, DQ, and MICA on the occurrence of Celiac disease in patients with type 1 diabetes.
20492596 2010 Distribution of KIR genes in the population of unrelated individuals homozygous for ancestral haplotype AH8.1 (HLA-A1B8DR3).
20483367 2010 Role of killer cell immunoglobulin-like receptor gene content and human leukocyte antigen-C group in susceptibility to human T-lymphotropic virus 1-associated myelopathy/tropical spastic paraparesis in Peru.
20478772 HLA-A, -B, -DRB1 alleles and haplotypes frequencies in Moroccan patients with leukemia.
20462405 2010 HLA Class I and II profiles in São Miguel Island (Azores): genetic diversity and linkage disequilibrium.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20454561 2010 A novel cancer vaccine strategy based on HLA-A*0201 matched allogeneic plasmacytoid dendritic cells.
20449807 2010 Analysis of HLA-A, HLA-B and HLA-DRB1 alleles in Chinese patients with lung cancer.
20448347 2010 HLA-A, -B, and -DRB1 gene polymorphism in the Miao ethnic group of Hunan, China.
20438789 2010 Association of HLA-A, -B, and -DRB1 with pulmonary tuberculosis in western Javanese Indonesia.
20426625 HLA and KIR frequencies in Sicilian Centenarians.
20410501 2010 Variant of TYR and autoimmunity susceptibility loci in generalized vitiligo.
20388056 2010 Human leukocyte antigen class I alleles and the risk of chronic myelogenous leukemia: a meta-analysis.
20385791 2010 Human leukocyte antigen class I and II alleles in non-Hodgkin lymphoma etiology.
20335254 2010 Different in vivo effects of HIV-1 immunodominant epitope-specific cytotoxic T lymphocytes on selection of escape mutant viruses.
20335219 2010 Impact of highly conserved HLA haplotype on acute graft-versus-host disease.
20334121 2009 Association of human leukocyte antigen and esophageal cancer in North of Iran.
20331834 2010 Report from the killer immunoglobulin-like receptor (KIR) anthropology component of the 15th International Histocompatibility Workshop: worldwide variation in the KIR loci and further evidence for the co-evolution of KIR and HLA.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20308568 2010 HLA-A alleles and infectious mononucleosis suggest a critical role for cytotoxic T-cell response in EBV-related Hodgkin lymphoma.
20307907 2010 The impact of anti-HY responses on outcome in current and subsequent pregnancies of patients with recurrent pregnancy losses.
20300120 2010 HLA and CTLA4 polymorphisms may confer a synergistic risk in the susceptibility to Graves' disease.
20235791 2010 Common risk allele in aromatic antiepileptic-drug induced Stevens-Johnson syndrome and toxic epidermal necrolysis in Han Chinese.
20230525 2010 HLA class I and II alleles and haplotypes in ethnic Northeast Thais.
20224785 2010 Human leukocyte antigens and HIV type 1 viral load in early and chronic infection: predominance of evolving relationships.
20220067 2010 The nature of peptides presented by an HLA class I low expression allele.
20219611 2010 Allelic diversity and haplotype structure of HLA loci in the Chinese Han population living in the Guanzhong region of the Shaanxi province.
20212098 2010 Single-chain HLA-A2 MHC trimers that incorporate an immundominant peptide elicit protective T cell immunity against lethal West Nile virus infection.
20210918 2010 Distribution of killer cell immunoglobulin-like receptor genes in the mestizo population from Venezuela.
20196826 2010 HLA-A, -B, -DRB1 allele frequencies and haplotypic association from DNA typing data of 7096 Korean cord blood units.
20196825 2010 HLA polymorphism in three indigenous populations of Sabah and Sarawak.
20193031 2010 Compound KIR-HLA genotype analyses in the Iranian population by a novel PCR-SSP assay.
20174631 2010 Immunoproteasome LMP2 60HH variant alters MBP epitope generation and reduces the risk to develop multiple sclerosis in Italian female population.
20173792 2010 The role of killer immunoglobulin-like receptor haplotypes on the outcome of unrelated donor haematopoietic SCT for thalassaemia.
20173784 2010 The beneficial impact of missing KIR ligands and absence of donor KIR2DS3 gene on outcome following unrelated hematopoietic SCT for myeloid leukemia in the Chinese population.
20169624 2010 Specific human leukocyte antigen class I and II alleles associated with hepatitis C virus viremia.
20154067 2010 Association of HLA-A, -B and -DRB1 genotype with birthweight and CD34+ cell content: analysis of Korean newborns and their cord blood.
20147981 2010 Human leukocyte antigen (HLA) A1-B8-DR3 (8.1) haplotype, tumor necrosis factor (TNF) G-308A, and risk of non-Hodgkin lymphoma.
20145915 2010 HLA class I and class II HLA DRB profiles in Egyptian children with rheumatic valvular disease.
20141578 2010 HLA-DRB1*11: a strong risk factor for acquired severe ADAMTS13 deficiency-related idiopathic thrombotic thrombocytopenic purpura in Caucasians.
20136775 2010 Haplotype-specific sequencing reveals a novel HLA-A*03 allele, A*030114.
20124097 2010 A novel HLA (HLA-A*0201) transgenic rabbit model for preclinical evaluation of human CD8+ T cell epitope-based vaccines against ocular herpes.
20103633 2010 NF-kappaB, and not MYCN, regulates MHC class I and endoplasmic reticulum aminopeptidases in human neuroblastoma cells.
20097244 2010 MICA polymorphism in a northern Chinese Han population: The identification of a new MICA allele, MICA*059.
20090103 2009 Association of HLA alleles with hepatitis C infection in Maharashtra, western India.
20087941 2010 Evaluation of host genetic and viral factors as surrogate markers for HTLV-1-associated myelopathy/tropical spastic paraparesis in Peruvian HTLV-1-infected patients.
20082482 2010 Immunogenetic characteristics of patients with autoimmune gastritis.
20074462 HLA-A*01 is associated with late onset of Alzheimer's disease in Italian patients.
20073992 2010 Association between HLA-B*4001 and lipodystrophy among HIV-infected patients from Thailand who received a stavudine-containing antiretroviral regimen.
20072141 2010 Haplotype-dependent HLA susceptibility to nasopharyngeal carcinoma in a Southern Chinese population.
20069393 2011 HLA-A and breast cancer in West Peninsular Malaysia.
20065111 2010 TCR mimic monoclonal antibody targets a specific peptide/HLA class I complex and significantly impedes tumor growth in vivo using breast cancer models.
20041166 2009 Common genetic variation and the control of HIV-1 in humans.
20032191 2010 Human leukocyte antigen class I supertypes and HIV-1 control in African Americans.
20030786 2010 HLA-G*0105N and HLA-G 14 bp dimorphisms in exon 8 in four distinct populations in mainland China.
20003377 2009 Association of HLA-A, B, DRB1 alleles and haplotypes with HIV-1 infection in Chongqing, China.
20003137 2010 HLA alleles and haplotypes distribution in Dai population in Yunnan province, Southwest China.
20003135 2010 Molecular analysis of HLA Class I and Class II genes in four indigenous Malaysian populations.
19968064 2009 [Effects of killer immunoglobulin-like receptor and human leukocyte antigen class I ligand on the prognosis of related donor hematopoietic stem cell transplantation].
19959637 2010 A new HLA extended haplotype containing the A*2910 allele in birdshot retinochoroidopathy: susceptibility narrowed to the HLA molecule itself.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19946888 2010 Defining the membrane proteome of NK cells.
19934297 2009 KIR and HLA genotypes are associated with disease progression and survival following autologous hematopoietic stem cell transplantation for high-risk neuroblastoma.
19932885 2010 Association of HLA class I alleles with keloids in Chinese Han individuals.
19931565 2010 Human leukocyte antigen alleles and the response to pegylated interferon/ribavirin therapy in chronic hepatitis C patients.
19925877 2010 Nonmyeloablative HLA-haploidentical bone marrow transplantation with high-dose posttransplantation cyclophosphamide: effect of HLA disparity on outcome.
19924143 2010 Diverging effects of HLA-DPB1 matching status on outcome following unrelated donor transplantation depending on disease stage and the degree of matching for other HLA alleles.
19920778 2009 Predicting HLA class I alloantigen immunogenicity from the number and physiochemical properties of amino acid polymorphisms.
19915238 Comparative case control study of clinical features and human leukocyte antigen susceptibility between familial and nonfamilial vitiligo.
19907433 2010 HLA-class I markers and multiple sclerosis susceptibility in the Italian population.
19896518 2010 Effect of human leukocyte antigen homozygosity on rubella vaccine-induced humoral and cell-mediated immune responses.
19883394 2010 Hypermethylation of HLA class I gene is associated with HLA class I down-regulation in human gastric cancer.
19879913 2010 HLA-DRB1*01 allele and low plasma immunoglobulin G1 concentration may predispose to herpes-associated recurrent lymphocytic meningitis.
19865101 2010 Genetic variants of CC chemokine genes in experimental autoimmune encephalomyelitis, multiple sclerosis and rheumatoid arthritis.
19861144 2010 Activating killer cell immunoglobulin-like receptors 3DS1 and 2DS1 protect against developing the severe form of recurrent respiratory papillomatosis.
19860590 2009 The frequency of HLA class I and II alleles in Pakistani patients with aplastic anemia.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19850842 2010 Killer cell immunoglobulin-like receptors in HLA-B27-associated acute anterior uveitis, with and without axial spondyloarthropathy.
19845915 2009 Molecular variation at the HLA-A, B, C, DRB1, DQA1, and DQB1 loci in full heritage American Indians in Arizona: private haplotypes and their evolution.
19834793 2010 IgA deficiency and the MHC: assessment of relative risk and microheterogeneity within the HLA A1 B8, DR3 (8.1) haplotype.
19820376 2009 Human leukocyte antigens I and II haplotypes associated with human papillomavirus 16-positive invasive cervical cancer in Mexican women.
19803716 2009 Short communication: association of HLA-A*1101 with resistance and B*4006 with susceptibility to HIV and HIV-TB: an in silico analysis of promiscuous T cell epitopes.
19802382 2009 Dengue virus infection and virus-specific HLA-A2 restricted immune responses in humanized NOD-scid IL2rgammanull mice.
19774073 2009 Genetic epidemiology of glioblastoma multiforme: confirmatory and new findings from analyses of human leukocyte antigen alleles and motifs.
19762282 2009 Behavior of non-classical soluble HLA class G antigens in human immunodeficiency virus 1-infected patients before and after HAART: comparison with classical soluble HLA-A, -B, -C antigens and potential role in immune-reconstitution.
19752231 2009 Dimorphic motifs in D0 and D1+D2 domains of killer cell Ig-like receptor 3DL1 combine to form receptors with high, moderate, and no avidity for the complex of a peptide derived from HIV and HLA-A*2402.
19744147 2009 Thirty-six novel HLA alleles: 7 HLA-A, 11 HLA-B, 15 HLA-C and 3 HLA-DRB1.
19735485 2009 Analysis of the complete genomic sequence of HLA-A alleles in the Chinese Han population.
19728932 2009 HLA B27 as predisposition factor to suffer age related macular degeneration.
19728333 2010 The prognostic role of classical and nonclassical MHC class I expression in endometrial cancer.
19727231 2009 Polymorphism of HLA-A and HLA-B in pre-eclampsia.
19718441 2009 Full likelihood analysis of genetic risk with variable age at onset disease--combining population-based registry data and demographic information.
19714482 2010 HLA association with nasopharyngeal carcinoma in southern Tunisia.
19703245 2009 Human leukocyte antigen profile in HIV-1 infected individuals and AIDS patients from Chongqing, China.
19703234 2009 HLA allele and haplotype frequencies in the Albanian population and their relationship with the other European populations.
19703232 2009 Confirmation of allele HLA-A*3116 found in a family of a leukaemia patient with Caucasian and Caribbean origin.
19694795 2010 HLA class I markers in Japanese patients with carbamazepine-induced cutaneous adverse reactions.
19684014 2010 Genetics of Behçet disease inside and outside the MHC.
19683555 2009 Role of human leukocyte antigen, killer-cell immunoglobulin-like receptors, and cytokine gene polymorphisms in leptospirosis.
19683024 2009 Association of human leukocyte antigens with nasopharyngeal carcinoma in high-risk multiplex families in Taiwan.
19668019 2009 High-resolution HLA genotyping and severe cutaneous adverse reactions in lamotrigine-treated patients.
19664746 2009 Genome-wide association study reveals multiple nasopharyngeal carcinoma-associated loci within the HLA region at chromosome 6p21.3.
19663693 2009 Impact of select immunologic and virologic biomarkers on CD4 cell count decrease in patients with chronic HIV-1 subtype C infection: results from Sinikithemba Cohort, Durban, South Africa.
19654877 2009 Association between protective and deleterious HLA alleles with multiple sclerosis in Central East Sardinia.
19654407 2009 Donor-recipient mismatches in MHC class I chain-related gene A in unrelated donor transplantation lead to increased incidence of acute graft-versus-host disease.
19653987 2009 HLA class I and II polymorphisms in Mexican Mestizo patients with dengue fever.
19630074 2009 Killer immunoglobulin-like receptor ligand HLA-Bw4 protects against multiple sclerosis.
19589487 2009 HLA-A disparities illustrate challenges for ranking the impact of HLA mismatches on bone marrow transplant outcomes in the United States.
19571811 2009 Common polygenic variation contributes to risk of schizophrenia and bipolar disorder.
19561534 2009 A novel mouse model for evaluation and prediction of HLA-A2-restricted CEA cancer vaccine responses.
19544559 2009 Synergistic effect of HLA class II loci and cytokine gene polymorphisms on the risk of gastric cancer in Japanese patients with Helicobacter pylori infection.
19539218 2009 Effects of mismatching for minor histocompatibility antigens on clinical outcomes in HLA-matched, unrelated hematopoietic stem cell transplants.
19536817 2009 Undifferentiated nasopharyngeal carcinoma from a nonendemic area: protective role of HLA allele products presenting conserved EBV epitopes.
19523767 2009 HLA-B62 and HLA-DQ8 are associated with Complex Regional Pain Syndrome with fixed dystonia.
19523231 2009 HLA-A*0201-restricted CTL epitope of a novel osteosarcoma antigen, papillomavirus binding factor.
19502044 2009 Role of genetic susceptibility to latent adenoviral infection and decreased lung function.
19500315 2009 HLA haplotypes and birth weight variation: is your future going to be light or heavy?
19495996 2009 Risk for intentional violent death associated with HLA genotypes: a preliminary survey of deceased American organ donors.
19493233 2009 Distribution of HLA-A, -B, -Cw, and -DRB1 alleles and haplotypes in an isolated Han population in Southwest China.
19493232 2009 Killer immunoglobulin-like receptors (KIR2DL2 and/or KIR2DS2) in presence of their ligand (HLA-C1 group) protect against chronic myeloid leukaemia.
19490212 2009 HLA class I and class II polymorphisms in Saudi patients with myasthenia gravis.
19490211 2009 HLA genes in Uros from Titikaka Lake, Peru: origin and relationship with other Amerindians and worldwide populations.
19487887 2009 Human leukocyte antigen frequency in human high-grade gliomas: a case-control study in Sicily.
19482867 2009 Protective role of the HLA-A*02 allele in Portuguese patients with multiple sclerosis.
19480851 2009 High-resolution human leukocyte antigen (HLA) haplotypes and linkage disequilibrium of HLA-B and -C and HLA-DRB1 and -DQB1 alleles in a Taiwanese population.
19429597 2009 The effect of the MHC locus on autoantibodies in type 1 diabetes.
19428110 2009 IRF-1 and p65 mediate upregulation of constitutive HLA-A antigen expression by hepatocellular carcinoma cells.
19409091 2009 Ethnic and geographical differences in HLA associations with the outcome of hepatitis C virus infection.
19407364 2009 HLA haplotype A33-B58-Cw10 may modulate radiographic development of bamboo spine in Taiwanese patients with primary ankylosing spondylitis.
19392852 2010 Polymorphisms of HLA-A and HLA-B genes in genetic susceptibility to esophageal carcinoma in Chaoshan Han Chinese.
19392836 2009 Haplotype analysis of HLA-A, -B antigens and -DRB1 alleles in south Indian HIV-1-infected patients with and without pulmonary tuberculosis.
19364514 2009 HLA polymorphism in six Malay subethnic groups in Malaysia.
19351501 2009 [Prediction and modification analysis of low-affinity HLA-A*0201 restricted CTL epitopes derived from HIV-1 pol antigen].
19350523 2009 [Analysis on haplotypes of five HLA loci in southern Chinese Han population by sequence-based typing].
19349081 2009 HLA class I and II alleles and response to treatment with interferon-beta in relapsing-remitting multiple sclerosis.
19348686 2009 Identification of HLA-A*02-B*46 haplotype allele variant in Guangdong Han populations on the basis of PCR-SBT.
19337647 2009 HLA-A *3303* and *3301 predispose patients to persistent hepatitis B infection.
19323028 2009 Identification of HLA-A24 restricted pre-erythrocytic stage specific T-cell epitopes using Plasmodium falciparum synthetic peptides: a preliminary study.
19299434 2009 Is neuromyelitis optica associated with human leukocyte antigen?
19278738 2009 Association of HLA-A in autoimmune myasthenia gravis with thymoma.
19276793 2009 Host genetics and HIV-1 viral load set-point in African-Americans.
19265139 2009 Class I HLA folding and antigen presentation in beta 2-microglobulin-defective Daudi cells.
19254258 2009 HLA class I allele and haplotype diversity in Ugandans supports the presence of a major east African genetic cluster.
19246116 2009 Analysis of HLA class I and II alleles regarding to lymph node and distant metastasis in patients with non-small cell lung cancer.
19235017 2009 HLA risk markers for chronic myelogenous leukemia in Eastern Canada.
19232441 2009 Gene-environment interactions between HLA B7/A2, EBV antibodies are associated with MRI injury in multiple sclerosis.
19227412 HLA types in Turkish children with celiac disease.
19223392 2009 Association of HY-restricting HLA class II alleles with pregnancy outcome in patients with recurrent miscarriage subsequent to a firstborn boy.
19219503 HLA antigens and nontuberculous mycobacterial lung disease in Korean patients.
19214504 2009 The common Scandinavian human leucocyte antigen ancestral haplotype 62.1 as prognostic factor in patients with advanced malignant melanoma.
19200828 2009 HLA haplotype and supertype associations with cellular immune responses and cytokine production in healthy children after rubella vaccine.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19199259 2009 [Analysis of HLA haplotype frequency and linkage disequilibrium in patients with acute lymphoblastic leukemia from Northern Chinese Han].
19196481 2009 High resolution human leukocyte antigen (HLA) class I and class II allele typing in Mexican mestizo women with sporadic breast cancer: case-control study.
19195705 2009 Discrimination of HLA null and low expression alleles by cytokine-induced secretion of recombinant soluble HLA.
19180512 2009 HLA-E gene polymorphism associated with susceptibility to Kawasaki disease and formation of coronary artery aneurysms.
19167759 2009 HLA-association of serum levels of natural antibodies.
19165231 2009 HLA-DPB1 and NFKBIL1 may confer the susceptibility to chronic thromboembolic pulmonary hypertension in the absence of deep vein thrombosis.
19159415 2009 High-resolution HLA matching in double-umbilical-cord-blood reduced-intensity transplantation in adults.
19155500 2009 A comparative study of HLA binding affinity and ligand diversity: implications for generating immunodominant CD8+ T cell responses.
19148489 2009 Capability of SART3(109-118) peptide to induce cytotoxic T lymphocytes from prostate cancer patients with HLA class I-A11, -A31 and -A33 alleles.
19143818 2009 Analysis of maternal-offspring HLA compatibility, parent-of-origin and non-inherited maternal effects for the classical HLA loci in type 1 diabetes.
19143813 2009 Confirmation of HLA class II independent type 1 diabetes associations in the major histocompatibility complex including HLA-B and HLA-A.
19143812 2009 The frequent and conserved DR3-B8-A1 extended haplotype confers less diabetes risk than other DR3 haplotypes.
19140832 2009 Polymorphisms of HLA genes in Western Javanese (Indonesia): close affinities to Southeast Asian populations.
19127112 2008 [Allele and haplotype frequencies of human leukocyte antigen-A, -B, and -DR loci in Koreans: DNA typing of 1,500 cord blood units].
19124746 2009 Ig-like transcript 4 inhibits lipid antigen presentation through direct CD1d interaction.
19112225 2009 HLA class I and II antigens expression in patients with renal cell carcinoma.
19104471 2009 HLA-B*3505 allele is a strong predictor for nevirapine-induced skin adverse drug reactions in HIV-infected Thai patients.
19100395 2008 Lymphocytic HLA-A mRNA is a reliable indicator of acute rejection in renal transplantation.
19096254 2008 [Clinical outcomes of lamivudine therapy and HLA alleles in chronic hepatitis B patients].
19063987 2009 Escape mutation selected by Gag28-36-specific cytotoxic T cells in HLA-A*2402-positive HIV-1-infected donors.
19054371 2008 Polymorphic insertions in 5 Alu loci within the major histocompatibility complex class I region and their linkage disequilibria with HLA alleles in four distinct populations in mainland China.
19052350 2008 Human leukocyte antigens (HLA) associated with selective IgA deficiency in Iran and Sweden.
19047245 2008 HLA-A33 is associated with susceptibility to enterovirus 71 infection.
19046300 2008 HLA haplotypes in recurrent aphthous stomatitis: a mode of inheritance?
19033208 2008 HLA-A amino acid polymorphism and delayed kidney allograft function.
19030725 2008 HLA profile in patients with AIDS and tuberculosis.
19024262 2008 [Haplotipic associations of the two most common HLA-B*27 alleles in the Croatian population].
19023492 HLA class I and II and TNF-alpha gene polymorphisms in sarcoidosis patients.
19019964 2009 HLA-associated clinical progression correlates with epitope reversion rates in early human immunodeficiency virus infection.
19000146 2008 HLA-A polymorphisms in four ethnic groups from Guinea-Bissau (West Africa) inferred from sequence-based typing.
19000143 2008 Outcome of haematopoietic stem cell transplantation in patients transplanted with matched unrelated donors vs allele-mismatched donors: a single centre study.
19000142 2008 Development and clinical evaluation of a microarray for HLA-A and -DRB1 genotyping.
19000140 2009 HLA-A, -B, -C, and -DRB1 allele and haplotype frequencies distinguish Eastern European Americans from the general European American population.
18987644 2009 Genetic variants of the HLA-A, HLA-B and AIF1 loci show independent associations with type 1 diabetes in Norwegian families.
18982067 2008 HIV-1 disease-influencing effects associated with ZNRD1, HCP5 and HLA-C alleles are attributable mainly to either HLA-A10 or HLA-B*57 alleles.
18976440 2008 The clinical implications of HLA mismatches in unrelated donor haematopoietic cell transplantation.
18976432 2008 HLA-A, B, Cw, DRB1, DQB1 and DPB1 alleles and haplotypes in the genetically homogenous Irish population.
18971283 2009 HLA-associated alterations in replication capacity of chimeric NL4-3 viruses carrying gag-protease from elite controllers of human immunodeficiency virus type 1.
18958335 2008 Inhibitor-Immunology-Study. Different HLA-types seem to be involved in the inhibitor development in haemophilia A.
18949728 HLA class I typing in Egyptian childhood minimal change nephrotic syndrome.
18939942 2008 Association of smoking behavior with an odorant receptor allele telomeric to the human major histocompatibility complex.
18936542 2008 Association between HLA-A alleles and Alzheimer's disease in a southern Chinese community.
18922348 2008 Evaluation of HLA-A, -B, -Cw, and -DRB1 alleles frequency in Turkish patients with nasal polyposis.
18852273 2009 Polymorphism in the human major histocompatibility complex and early viral decline during treatment of chronic hepatitis C.
18848853 2008 Killer cell immunoglobulin-like receptor gene diversity in a Southern Brazilian population from the state of Paraná.
18846964 2008 [Human leukocyte antigen genes to genetic predisposition in diffuse panbronchiolitis].
18827882 2008 Protective and enhancing HLA alleles, HLA-DRB1*0901 and HLA-A*24, for severe forms of dengue virus infection, dengue hemorrhagic fever and dengue shock syndrome.
18801059 2009 HLA-A*0201 is associated with a better outcome after donor lymphocyte infusion for recurrent malignancy.
18797890 2009 Ethnic differences in immunogenetic features and photosensitivity of cutaneous lupus erythematosus.
18786593 2008 Association study of HLA-A gene and schizophrenia in Han Chinese from Taiwan.
18782112 2008 Soluble HLA-G and HLA-A,-B,-C serum levels in patients with allergic rhinitis.
18778326 2008 Association between killer-cell immunoglobulin-like receptor genotypes and leprosy in Brazil.
18770861 2008 HLA-A2-restricted CTL epitopes of a novel lung cancer-associated cancer testis antigen, cell division cycle associated 1, can induce tumor-reactive CTL.
18769915 2008 The peptide-binding specificity of HLA-A*3001 demonstrates membership of the HLA-A3 supertype.
18768435 2008 Matched unrelated or matched sibling donors result in comparable survival after allogeneic stem-cell transplantation in elderly patients with acute myeloid leukemia: a report from the cooperative German Transplant Study Group.
18761557 2008 Association of human leukocyte antigen polymorphism with outcomes of hepatitis B virus infection.
18755927 2008 Post-transplantation lymphoproliferative disease: Epstein-Barr virus DNA levels, HLA-A3, and survival.
18721279 2008 A new HLA-A*02 null allele, HLA-A*9213N.
18721271 2008 HLA-A, -B and -DRB1 allele frequencies in the Bangladeshi population.
18718089 2008 [Expression and analysis of HLA-A, B and DRB1 genes in patients with chronic myelogenous leukemia in Guangdong area].
18716994 2008 Genetic polymorphisms at HLA-A, -B, and -DRB1 loci in Han population of Xi'an city in China.
18689790 2009 The association of anti-r-HuEpo-associated pure red cell aplasia with HLA-DRB1*09-DQB1*0309.
18684953 2008 Human leukocyte antigen class I genotypes in relation to heterosexual HIV type 1 transmission within discordant couples.
18684101 2008 The HCP5 single-nucleotide polymorphism: a simple screening tool for prediction of hypersensitivity reaction to abacavir.
18683155 2008 [Study of the HLA-A, B, DRB1 allele and haplotype frequencies of 4194 cord blood samples in Guangzhou].
18613417 Genetic distinctions and clinical characteristics of type 1 autoimmune hepatitis in Taiwan.
18589099 2008 HLA polymorphisms as incidence factor in the progression to end-stage renal disease in Brazilian patients awaiting kidney transplant.
18583252 2008 [Association of HLA-A, B and DRB1 alleles with leukemia in Han population in Hunan Province].
18582515 2008 Human leukocyte antigen-A, -B, and -DRB1 haplotypes of cord blood units in the Tzu Chi Taiwan Cord Blood Bank.
18580606 2008 Human leukocyte antigen-specific polymorphisms in HIV-1 Gag and their association with viral load in chronic untreated infection.
18578977 HLA-B*27/HLA-B*07 in combination with D6S273-134 allele is associated with increased susceptibility to juvenile spondyloarthropathies.
18571006 2008 KIR and HLA gene combinations in Vogt-Koyanagi-Harada disease.
18566379 2008 Identification of a novel immunogenic HLA-A*0201-binding epitope of HER-2/neu with potent antitumor properties.
18544086 2008 Impact of HLA-DPB1 allelic and single amino acid mismatches on HSCT.
18521626 2009 HLA class I alleles in HTLV-1-associated myelopathy and asymptomatic carriers from the Brazilian cohort GIPH.
18520158 2008 HLA class I and class II genotyping in patients with chronic urticaria.
18517005 2008 [Four-digit allele genotyping of HLA-A and HLA-B genes in Japanese patients with Behçet's disease (BD) by a PCR-SSOP-luminex method and stratification analysis according to each major symptom of BD].
18502829 2008 Human leukocyte antigens A23, A24, and A32 but not A25 are ligands for KIR3DL1.
18501999 2008 HLA and response to booster hepatitis B vaccination in anti-HBs-seronegative adolescents who had received primary infantile vaccination.
18486765 Type 1 diabetes risk for human leukocyte antigen (HLA)-DR3 haplotypes depends on genotypic context: association of DPB1 and HLA class I loci among DR3- and DR4-matched Italian patients and controls.
18458507 2008 [Association of HLA-A, B antigens with susceptibility to advanced endometriosis in Koreans].
18451182 2008 Comprehensive analysis of HLA-A, HLA-B, HLA-C, HLA-DRB1, and HLA-DQB1 loci and squamous cell cervical cancer risk.
18434400 2008 HLA class I-driven evolution of human immunodeficiency virus type 1 subtype c proteome: immune escape and viral load.
18399156 2007 [Study on the relationship between chronic glomerulonephritis and human leukocyte antigen in Shandong province].
18396213 2008 Paroxysmal nocturnal hemoglobinuria: significant association with specific HLA-A, -B, -C, and -DR alleles in an Italian population.
18385790 2008 HLA class I and II gene polymorphisms in Stevens-Johnson syndrome with ocular complications in Japanese.
18385451 2008 The reactivity of Bw4+ HLA-B and HLA-A alleles with KIR3DL1: implications for patient and donor suitability for haploidentical stem cell transplantations.
18381784 2008 Human leukocyte antigen and clinical and demographic characteristics in psoriatic arthritis and psoriasis in Chinese patients.
18370845 2008 Case-control study of the association between select HLA genes and anti-erythropoietin antibody-positive pure red-cell aplasia.
18363871 2008 Identification of HLA-A2 restricted T-cell epitopes within the conserved region of the immunoglobulin G heavy-chain in patients with multiple myeloma.
18361931 2008 The clinical significance of soluble human leukocyte antigen class-I, ICTP, and RANKL molecules in multiple myeloma patients.
18359130 2009 Association study of the HLA-A2 allele in Italian Alzheimer disease patients.
18347914 2008 The diversity of KIR gene in Chinese Northern Han population and the impact of donor KIR and patient HLA genotypes on outcome following HLA-identical sibling allogeneic hematopoietic stem cell transplantation for hematological malignancy in Chinese people.
18344933 2007 Associations of Human Leukocyte Antigen (HLA) haplotypes with risk of developing lymphoproliferative disorders after renal transplantation.
18340360 2008 Combination of KIR and HLA gene variants augments the risk of developing birdshot chorioretinopathy in HLA-A*29-positive individuals.
18332066 2008 HLA-DQ3 is a probable risk factor for CMV infection in high-risk kidney transplant patients.
18320121 2007 [Human leucocyte antigen gene (HLA-A, HLA-B, HLA-DRB1) frequencies in deceased organ donors].
18301962 2008 Association of HLA alleles with non-Hodgkin's lymphoma in Korean population.
18295677 2008 Distribution of HLA alleles and haplotypes in Jinuo and Wa populations in Southwest China.
18273034 2008 A population-specific diabetogenic haplotype HLA-A2,Cw1,B56,DR4,DQ8 is associated with high birthweight in Finnish diabetic families.
18256425 2008 HLA-DRB1*04 allele is associated with severe malaria in northern Ghana.
18244920 2008 [HLA-A, B, and DRB1 gene polymorphisms in Mongol ethnic group of Inner Mongolia, China].
18241227 2008 Human leucocyte antigen class II association in idiopathic bronchiectasis, a disease of chronic lung infection, implicates a role for adaptive immunity.
18240960 2008 Cytokine genotype suggests a role for inflammation in nucleoside analog-associated sensory neuropathy (NRTI-SN) and predicts an individual's NRTI-SN risk.
18236804 2007 HLA- A, B, DR and DQ alleles study in Tunisian patients with atopic dermatitis.
18223493 2008 Frequency of concurrent autoimmune disorders in patients with autoimmune hepatitis: effect of age, gender, and genetic background.
18201363 2008 A new HLA-A*24 variant, A*2475, identified by sequence-based typing in the Korean population.
18190553 2008 Human leukocyte antigen polymorphism in chronic and aggressive periodontitis among Caucasians: a meta-analysis.
18186801 2008 Lack of association between HLA-A, -B and -DRB1 alleles and the development of SARS: a cohort of 95 SARS-recovered individuals in a population of Guangdong, southern China.
18093280 2008 Role of minor histocompatibility antigens in renal transplantation.
18088468 2007 [Correlation of HLA-alleles with aplastic anemia].
18086267 2008 HLA-A, -B, -C, -DRB1 and -DQB1 alleles and haplotypes in the Kinh population in Vietnam.
18085998 2007 Investigation into the multidimensional genetic basis of drug-induced Stevens-Johnson syndrome and toxic epidermal necrolysis.
18082573 2007 HLA class I polymorphism in the Cuban population.
18078206 2007 HLA class I and class II polymorphism in three Sicilian populations.
18074415 2007 Hla-Cw7 allele as predictor of favorable therapeutic response to interferon-alpha in patients with chronic hepatitis C.
18070207 2008 Genotyping of HLA-I and HLA-II alleles in Chinese patients with paraneoplastic pemphigus.
18069934 2008 Thirty-two novel HLA-A alleles identified during intermediate resolution testing.
18065518 2008 Analysis of single nucleotide polymorphisms identifies major type 1A diabetes locus telomeric of the major histocompatibility complex.
18064508 2008 Polymorphisms of human leukocyte antigen genes in korean children with Kawasaki disease.
18057683 2007 Association of HLA-*08:DRB1*03 with immunoglobulin A-deficiency.
18035044 2008 Different immunodominance of HIV-1-specific CTL epitopes among three subtypes of HLA-A*26 associated with slow progression to AIDS.
18022727 2008 Susceptibility to type 1 autoimmune hepatitis is associated with shared amino acid sequences at positions 70-74 of the HLA-DRB1 molecule.
18004301 2007 Localization of type 1 diabetes susceptibility to the MHC class I genes HLA-B and HLA-A.
18001297 2007 The polymorphism and haplotype analysis of HLA-A, -B and -DRB1 genes of population in Jiangsu province of China.
17997746 2007 Association of killer cell immunoglobulin-like receptor genotypes with susceptibility to endometriosis.
17990991 2007 Identified a novel allele HLA-A*240212 by sequence-based typing.
17989838 2007 [Genetic susceptibility to Andes Hantavirus: Association between severity of disease and HLA alíeles in Chilean patients].
17989341 2008 Association of Chlamydia pneumoniae infection with HLA-B*35 in patients with coronary artery disease.
17971052 2008 Haplotype-specific pattern of association of human major histocompatibility complex with non-Hodgkin's lymphoma outcome.
17971048 2008 SNP mapping and candidate gene sequencing in the class I region of the HLA complex: searching for multiple sclerosis susceptibility genes in Tasmanians.
17964196 Immunogenetic factors in donors and patients that affect the outcome of hematopoietic stem cell transplantation.
17961775 2007 HLA-A, -B, -DR haplotype frequencies from DNA typing data of 26,266 Chinese bone marrow donors.
17956696 2007 [Haplotype and linkage analysis of HLA-I classical genes in Chinese Han population].
17927716 2007 Genetic contribution of major histocompatibility complex class II region to type 1 autoimmune hepatitis susceptibility in Venezuela.
17924859 2007 The HLA-A1-B8 haplotype hitchhiking with the hemochromatosis mutation: does it affect the phenotype?
17922429 2007 [Study on correlation between HLA-A, B, DR alleles and Duchenne muscular dystrophy].
17911430 2007 Genetic control of immune response in carriers of the 8.1 ancestral haplotype: correlation with levels of IgG subclasses: its relevance in the pathogenesis of autoimmune diseases.
17909631 2007 HLA class I polymorphisms are associated with development of infectious mononucleosis upon primary EBV infection.
17900288 2007 HLA class I (A, B, C) and class II (DRB1, DQA1, DQB1, DPB1) alleles and haplotypes in the Han from southern China.
17891921 2007 HLA-A, -B and -DR allele and haplotype frequencies in Malays.
17869653 2007 High-resolution HLA alleles and haplotypes in the United States population.
17853492 2008 Clonal T-cell response against autologous pleomorphic malignant fibrous histiocytoma antigen presented by retrieved HLA-A*0206.
17845299 2007 HLA analysis of Sri Lankan Sinhalese predicts North Indian origin.
17825227 2007 [Correlation of the polymorphism of HLA-A, B and DRB1 alleles with nasopharyngeal carcinoma in the south of China].
17785583 2007 High-resolution donor-recipient HLA matching contributes to the success of unrelated donor marrow transplantation.
17784873 2007 Identification of human leukocyte antigen-A24-restricted epitope peptides derived from gene products upregulated in lung and esophageal cancers as novel targets for immunotherapy.
17763415 2007 HLA-DRB4 as a genetic risk factor for Churg-Strauss syndrome.
17726164 2007 The importance of HLA-DPB1 in unrelated donor hematopoietic cell transplantation.