Property Summary

NCBI Gene PubMed Count 27
PubMed Score 21.97
PubTator Score 26.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
osteosarcoma -2.046 7.9e-03
glioblastoma 2.500 1.6e-05
sonic hedgehog group medulloblastoma 2.800 1.5e-08
atypical teratoid / rhabdoid tumor 2.300 2.2e-12
medulloblastoma, large-cell 2.800 9.7e-07
primitive neuroectodermal tumor 2.600 3.0e-05
Atopic dermatitis 1.500 3.5e-05
adrenocortical carcinoma 1.283 3.1e-03
non-small cell lung cancer 2.608 3.1e-32
intraductal papillary-mucinous carcinoma... 1.100 2.1e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.6e-04
lung cancer 2.900 1.8e-05
colon cancer 1.800 2.8e-02
lung adenocarcinoma 1.400 7.0e-08
pediatric high grade glioma 2.100 1.1e-06
posterior fossa group A ependymoma 1.200 2.0e-04
Endometriosis 1.092 1.0e-02
Breast cancer 2.100 2.5e-15
ductal carcinoma in situ 1.200 8.5e-03
invasive ductal carcinoma 1.300 2.0e-03
ovarian cancer 1.800 2.3e-09
psoriasis 1.600 4.5e-134

Gene RIF (21)

PMID Text
26863619 An increased occurrence of hepatocellular carcinoma was consistently associated with A/C or C/C genotypes of the non-synonymous SNP rs3771333 compared with the A/A genotype in both the Fusui and Haimen populations.
26063729 Authors propose that this centromere expansion activity reflects the functional properties of HJURP, which uses this activity to contribute to the plastic establishment of a centromeric chromatin structure.
25843710 On the basis of our findings, we propose that HJURP serves a dual chaperone function in coordinating CenH3(CENP-A) and CENP-C recruitment.
25497280 HJURP can discriminate favorable and unfavorable outcome within the luminal A subtype, outperforming the currently utilized proliferation marker Ki67, as an independent prognostic marker for luminal A patients.
25243117 3 biomarkers in 44 patients with in situ breast cancers were evaluated: TG2 (transglutaminase 2), HJURP (Holliday junction recognition protein), and HIF-1alpha (hypoxia inducible factor-1 alpha).
25117489 The study describes a novel function for human centromeric long non-coding RNAs in the recruitment of HJURP and CENP-A, implicating RNA-based chaperone targeting in histone variant assembly.
25001279 Phosphorylation state of HJURP controls its centromeric recruitment. HJURP binding to DNA promotes loading of CenH3CENP-A at centromeres.
24519934 Mis18beta binds with and specifies the centromere localization of HJURP.
24039914 The levels of the EDNRB, HJURP and p60/CAF-1 proteins were strongly associated with overall survival in high-grade gliomas patients (p<0.001, p<0.001 and p=0.002, respectively), whereas the one of PDLI4 was not (P=0.11).
23771058 a mechanism whereby the CENP-A pre-nucleosomal complex achieves assembly of the octameric CENP-A nucleosome through the dimerization of the CENP-A chaperone HJURP.
23638004 HJURP has an important role in the maintenance of extremely proliferative cells of high-grade gliomas
23292286 Downregulation of HJURP in young cells led to premature senescence. p53 knockdown, but not p16 knockdown, abolished senescence phenotypes caused by HJURP reduction.
23184928 And-1 together with HJURP regulates the assembly of new CENP-A onto centromeres.
21980305 stringent regulation of HJURP and SCM3 expression are critical for genome stability.
21768289 An amino-terminal fragment of HJURP was able to assemble CENP-A nucleosomes in vitro, demonstrating that HJURP is a chromatin assembly factor.
21478274 The crystal structure of an HJURP-CENP-A-histone H4 complex shows that HJURP binds a CENP-A-H4 heterodimer
20211017 Data show that HJURP mRNA level is a prognostic factor for disease-free and overall survival in patients with breast cancer and is a predictive biomarker for sensitivity to radiotherapy.
20080577 found that HJURP, a member of the complex, was required for cell cycle specific targeting of CENP-A to centromeres.
19410545 HJURP is a key factor for CENP-A deposition and maintenance at centromeres
19410544 HJURP is a possible cell-cycle-regulated CENP-A-specific histone chaperone required for centromeric chromatin assembly
16622419 hFLEG1 is associated with the CENP-A centromeric nucleosome

AA Sequence

MLGTLRAMEGEDVEDDQLLQKLRASRRRFQRRMQRLIEKYNQPFEDTPVVQMATLTYETPQGLRIWGGRL      1 - 70
IKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQS     71 - 140
PLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRVTPLPSLASPAVPAPGYCSRISRKSPGDPAKPAS    141 - 210
SPREWDPLHPSSTDMALVPRNDSLSLQETSSSSFLSSQPFEDDDICNVTISDLYAGMLHSMSRLLSTKPS    211 - 280
SIISTKTFIMQNWNSRRRHRYKSRMNKTYCKGARRSQRSSKENFIPCSEPVKGTGALRDCKNVLDVSCRK    281 - 350
TGLKLEKAFLEVNRPQIHKLDPSWKERKVTPSKYSSLIYFDSSATYNLDEENRFRTLKWLISPVKIVSRP    351 - 420
TIRQGHGENRQREIEIRFDQLHREYCLSPRNQPRRMCLPDSWAMNMYRGGPASPGGLQGLETRRLSLPSS    421 - 490
KAKAKSLSEAFENLGKRSLEAGRCLPKSDSSSSLPKTNPTHSATRPQQTSDLHVQGNSSGIFRKSVSPSK    491 - 560
TLSVPDKEVPGHGRNRYDEIKEEFDKLHQKYCLKSPGQMTVPLCIGVSTDKASMEVRYQTEGFLGKLNPD    561 - 630
PHFQGFQKLPSSPLGCRKSLLGSTAIEAPSSTCVARAITRDGTRDHQFPAKRPRLSEPQGSGRQGNSLGA    631 - 700
SDGVDNTVRPGDQGSSSQPNSEERGENTSYRMEEKSDFMLEKLETKSV                          701 - 748
//

Text Mined References (43)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
26863619 2016 A Non-Synonymous Single Nucleotide Polymorphism in the HJURP Gene Associated with Susceptibility to Hepatocellular Carcinoma among Chinese.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26063729 2015 HJURP is involved in the expansion of centromeric chromatin.
25843710 2015 HJURP involvement in de novo CenH3(CENP-A) and CENP-C recruitment.
25497280 2015 The histone chaperone HJURP is a new independent prognostic marker for luminal A breast carcinoma.
25243117 2014 New biomarkers to predict the evolution of in situ breast cancers.
25117489 2014 A long non-coding RNA is required for targeting centromeric protein A to the human centromere.
25001279 2014 Phosphorylation and DNA binding of HJURP determine its centromeric recruitment and function in CenH3(CENP-A) loading.
24519934 2014 Mitotic regulator Mis18? interacts with and specifies the centromeric assembly of molecular chaperone holliday junction recognition protein (HJURP).
24039914 2013 Prognostic significance of EDN/RB, HJURP, p60/CAF-1 and PDLI4, four new markers in high-grade gliomas.
23771058 2013 Dimerization of the CENP-A assembly factor HJURP is required for centromeric nucleosome deposition.
23638004 2013 Modulation of HJURP (Holliday Junction-Recognizing Protein) levels is correlated with glioblastoma cells survival.
23292286 2013 HJURP regulates cellular senescence in human fibroblasts and endothelial cells via a p53-dependent pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184928 2013 Acidic nucleoplasmic DNA-binding protein (And-1) controls chromosome congression by regulating the assembly of centromere protein A (CENP-A) at centromeres.
21980305 2011 Misregulation of Scm3p/HJURP causes chromosome instability in Saccharomyces cerevisiae and human cells.
21768289 2011 HJURP is a CENP-A chromatin assembly factor sufficient to form a functional de novo kinetochore.
21478274 2011 Structure of a CENP-A-histone H4 heterodimer in complex with chaperone HJURP.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20211017 2010 The expression level of HJURP has an independent prognostic impact and predicts the sensitivity to radiotherapy in breast cancer.
20080577 2010 HJURP binds CENP-A via a highly conserved N-terminal domain and mediates its deposition at centromeres.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19410545 2009 HJURP is a cell-cycle-dependent maintenance and deposition factor of CENP-A at centromeres.
19410544 2009 Centromere-specific assembly of CENP-a nucleosomes is mediated by HJURP.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17823411 2007 Activation of Holliday junction recognizing protein involved in the chromosomal stability and immortality of cancer cells.
17256767 2007 Identification of FAKTS as a novel 14-3-3-associated nuclear protein.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16622419 2006 The human CENP-A centromeric nucleosome-associated complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.