Property Summary

NCBI Gene PubMed Count 24
PubMed Score 49.92
PubTator Score 29.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Breast cancer -1.300 1.7e-04
adult high grade glioma -2.100 5.5e-05
Alzheimer's disease 1.200 1.9e-02
astrocytic glioma -1.600 9.0e-03
Atopic dermatitis 1.400 5.2e-03
atypical teratoid / rhabdoid tumor -3.100 1.5e-07
cystic fibrosis 1.009 6.9e-03
ependymoma -2.100 4.9e-03
gastric carcinoma 1.200 3.4e-02
glioblastoma -1.400 2.5e-03
group 4 medulloblastoma -1.300 3.8e-03
interstitial cystitis 1.300 2.7e-03
intraductal papillary-mucinous adenoma (... -1.400 1.1e-02
intraductal papillary-mucinous carcinoma... -1.700 5.2e-03
intraductal papillary-mucinous neoplasm ... -1.300 4.6e-02
medulloblastoma, large-cell -2.800 1.5e-04
oligodendroglioma -1.800 6.3e-03
osteosarcoma 1.369 4.7e-06
ovarian cancer -3.200 1.3e-15
Pick disease 1.300 3.9e-04
Pilocytic astrocytoma -1.100 1.7e-02
primitive neuroectodermal tumor -1.700 7.1e-03
progressive supranuclear palsy 1.100 1.5e-02
ulcerative colitis 1.600 5.5e-06
urothelial carcinoma -1.100 2.2e-03

Gene RIF (12)

AA Sequence

MDPEQSVKGTKKAEGSPRKRLTKGEAIQTSVSSSVPYPGSGTAATQESPAQELLAPQPFPGPSSVLREGS      1 - 70
QEKTGQQQKPPKRPPIEASVHISQLPQHPLTPAFMSPGKPEHLLEGSTWQLVDPMRPGPSGSFVAPGLHP     71 - 140
QSQLLPSHASIIPPEDLPGVPKVFVPRPSQVSLKPTEEAHKKERKPQKPGKYICQYCSRPCAKPSVLQKH    141 - 210
IRSHTGERPYPCGPCGFSFKTKSNLYKHRKSHAHRIKAGLASGMGGEMYPHGLEMERIPGEEFEEPTEGE    211 - 280
STDSEEETSATSGHPAELSPRPKQPLLSSGLYSSGSHSSSHERCSLSQSSTAQSLEDPPPFVEPSSEHPL    281 - 350
SHKPEDTHTIKQKLALRLSERKKVIDEQAFLSPGSKGSTESGYFSRSESAEQQVSPPNTNAKSYAEIIFG    351 - 420
KCGRIGQRTAMLTATSTQPLLPLSTEDKPSLVPLSVPRTQVIEHITKLITINEAVVDTSEIDSVKPRRSS    421 - 490
LSRRSSMESPKSSLYREPLSSHSEKTKPEQSLLSLQHPPSTAPPVPLLRSHSMPSAACTISTPHHPFRGS    491 - 560
YSFDDHITDSEALSHSSHVFTSHPRMLKRQPAIELPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELTK    561 - 630
KTKKGLKTKGVIYECNICGARYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMH    631 - 700
YKLGTTLELTPLRKRRKEKSLGDEEEPPAFESTKSQFGSPGPSDAARNLPLESTKSPAEPSKSVPSLEGP    701 - 770
TGFQPRTPKPGSGSESGKERRTTSKEISVIQHTSSFEKSDSLEQPSGLEGEDKPLAQFPSPPPAPHGRSA    771 - 840
HSLQPKLVRQPNIQVPEILVTEEPDRPDTEPEPPPKEPEKTEEFQWPQRSQTLAQLPAEKLPPKKKRLRL    841 - 910
AEMAQSSGESSFESSVPLSRSPSQESNVSLSGSSRSASFERDDHGKAEAPSPSSDMRPKPLGTHMLTVPS    911 - 980
HHPHAREMRRSASEQSPNVSHSAHMTETRSKSFDYGSLSLTGPSAPAPVAPPARVAPPERRKCFLVRQAS    981 - 1050
LSRPPESELEVAPKGRQESEEPQPSSSKPSAKSSLSQISSAATSHGGPPGGKGPGQDRPPLGPTVPYTEA   1051 - 1120
LQVFHHPVAQTPLHEKPYLPPPVSLFSFQHLVQHEPGQSPEFFSTQAMSSLLSSPYSMPPLPPSLFQAPP   1121 - 1190
LPLQPTVLHPGQLHLPQLMPHPANIPFRQPPSFLPMPYPTSSALSSGFFLPLQSQFALQLPGDVESHLPQ   1191 - 1260
IKTSLAPLATGSAGLSPSTEYSSDIRLPPVAPPASSSAPTSAPPLALPACPDTMVSLVVPVRVQTNMPSY   1261 - 1330
GSAMYTTLSQILVTQSQGSSATVALPKFEEPPSKGTTVCGADVHEVGPGPSGLSEEQSRAFPTPYLRVPV   1331 - 1400
TLPERKGTSLSSESILSLEGSSSTAGGSKRVLSPAGSLELTMETQQQKRVKEEEASKADEKLELVKPCSV   1401 - 1470
VLTSTEDGKRPEKSHLGNQGQGRRELEMLSSLSSDPSDTKEIPPLPHPALSHGTAPGSEALKEYPQPSGK   1471 - 1540
PHRRGLTPLSVKKEDSKEQPDLPSLAPPSSLPLSETSSRPAKSQEGTDSKKVLQFPSLHTTTNVSWCYLN   1541 - 1610
YIKPNHIQHADRRSSVYAGWCISLYNPNLPGVSTKAALSLLRSKQKVSKETYTMATAPHPEAGRLVPSSS   1611 - 1680
RKPRMTEVHLPSLVSPEGQKDLARVEKEEERRGEPEEDAPASQRGEPARIKIFEGGYKSNEEYVYVRGRG   1681 - 1750
RGKYVCEECGIRCKKPSMLKKHIRTHTDVRPYVCKHCHFAFKTKGNLTKHMKSKAHSKKCQETGVLEELE   1751 - 1820
AEEGTSDDLFQDSEGREGSEAVEEHQFSDLEDSDSDSDLDEDEDEDEEESQDELSRPSSEAPPPGPPHAL   1821 - 1890
RADSSPILGPQPPDAPASGTEATRGSSVSEAERLTASSCSMSSQSMPGLPWLGPAPLGSVEKDTGSALSY   1891 - 1960
KPVSPRRPWSPSKEAGSRPPLARKHSLTKNDSSPQRCSPAREPQASAPSPPGLHVDPGRGMGALPCGSPR   1961 - 2030
LQLSPLTLCPLGRELAPRAHVLSKLEGTTDPGLPRYSPTRRWSPGQAESPPRSAPPGKWALAGPGSPSAG   2031 - 2100
EHGPGLGLDPRVLFPPAPLPHKLLSRSPETCASPWQKAESRSPSCSPGPAHPLSSRPFSALHDFHGHILA   2101 - 2170
RTEENIFSHLPLHSQHLTRAPCPLIPIGGIQMVQARPGAHPTLLPGPTAAWVSGFSGGGSDLTGAREAQE   2171 - 2240
RGRWSPTESSSASVSPVAKVSKFTLSSELEGGDYPKERERTGGGPGRPPDWTPHGTGAPAEPTPTHSPCT   2241 - 2310
PPDTLPRPPQGRRAAQSWSPRLESPRAPTNPEPSATPPLDRSSSVGCLAEASARFPARTRNLSGEPRTRQ   2311 - 2380
DSPKPSGSGEPRAHPHQPEDRVPPNA                                               2381 - 2406
//

Text Mined References (28)

PMID Year Title