Property Summary

NCBI Gene PubMed Count 129
PubMed Score 9.93
PubTator Score 12.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
breast carcinoma 1614 4.8e-03

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.800 4.8e-03

Gene RIF (71)

PMID Text
26719341 Data suggest chromatin exhibits histone 3 methylation markers (H3K4me3, H3K27me3) in fetal brain, heart, and liver, probably to keep progenitor cells in these organs ready for immediate differentiation. (study of 12-week aborted embryo tissues, China)
26669263 EP400 deposits H3.3 into chromatin alongside H2AZ and contributes to gene regulation after Pol II pre-initiation complex assembly.
26575220 Regulators of the histone H3-trimethyl lysine-4 (H3K4me3) mark are significantly associated with the genetic risk architecture of common neurodevelopmental disease.
26482474 Screening for H3.3 G34 mutation should therefore be recommended as a routine diagnostic marker for supratentorial central nervous system tumors
26291278 Our data highlights the complex interplay between Nrf2 and H3S10 phosphorylation in arsenite-activated HO-1 transcription.
25712104 Data indicate the role for histone demethylase KDM5C/JARID1C in a specific phase of DNA replication in mammalian cells, through its demethylase activity on histone H3K4me3.
25696994 Posttranslational modifications of H3 histone (methylation) does not correlate with the sox2 expression in malignant gliomas.
25690891 Findings suggest a role of checkpoint kinase 1 (CHK1) as an histone H3.3 serine 31 kinase.
25560918 TIP60 interacted with H3K4me3 in response to TNF-alpha signaling.
25519907 histone H3 lysine 9 acetylation has a dual role in human embryonic stem cell pluripotency and neural differentiation
25519718 Paternal heterochromatin formation in human embryos is H3K9/HP1 directed and primed by sperm-derived histone modifications.
25482197 our data show that histone variant H3.3 occupies distinct intranuclear chromatin domains and that these genomic loci are associated with gene expression
25336637 Reptin and Pontin oligomerization and activity are modulated through histone H3 N-terminal tail interaction.
25281433 This study showed that Pediatric brainstem oligodendroglial tumors can include histone H3.3-mutated tumors and have a tendency to disseminate throughout the neuroaxis at the time of relapse.
25149548 Deregulation of histone H3 trimethylation at lysine 27 in diffuse large B-cell lymphoma may be another high-risk phenotype
24952159 Our data suggest that the modification and release of histones could serve markers of apoptosis in human cancer cells.
24744315 Data suggest riboflavin (RF) status regulates hepatocyte gene expression; in HepG2 cells, depletion of LSD1 (lysine (K)-specific demethylase 1A) causes aberrant gene regulation in RF-deficient cells via changes in H3 methylation at albumin promoter.
24656132 H3K4 monomethylation establishes boundaries that restrict the recruitment of chromatin-modifying enzymes to defined regions within promoters.
24614346 Concurrent acetylation and methylation at H3K27 occurs in hepatocellular carcinoma cells in association with p53 abnormalities.
24324728 The aim of the present study was to evaluate the prognostic value of the proliferation factors mitotic activity index (MAI), phosphohistone H3 (PPH3), cyclin B1, cyclin A and Ki67, alone and in combinations.
24235145 Data indicate that MLL1 methylates Ash2L in the absence of histone H3, but only when assembled within a complex with WDR5 and RbBP5.
24021213 Ki-67 staining is stronger than PHH3, making 'hot spots' easier to identify on ACIS. Ki-67 is more ideal than PHH3( Phosphohistone H3 ) for staining NENs, especially in tumors with borderline grades.
23954330 full-length PHF1 in HEK293 cells co-localizes with histone K27me3, but not with K36me3, and this co-localization depends on the trimethyllysine binding pocket indicating that K27me3 is an in vivo target for the PHF1 Tudor domain
23908241 SIRT2-mediated H3K18 deacetylation plays a critical role during infection, which reveals an epigenetic mechanism imposed by a pathogenic bacterium to reprogram its host.
23582659 Disruption of neocortical histone H3 homeostasis by soluble Abeta implicates Alzheimer's disease.
23579270 Menin-dependent transcriptional repression of histone H3 lysine 9 methylation might play an important role in preventing tumors.
23564320 Data indicate that S6 kinase 2 (S6K2) can phosphorylate histone H3 at position Thr45, which may play a role during cell proliferation and/or differentiation.
23541585 C-kinase-activated protein phosphatase (CPI)-17 inhibitor knockdown in human pancreatic cancer cells results in dephosphorylation of histone H3.
23541084 Results suggest that GLP may play a significant role in the maintenance of HIV-1 latency by catalyzing dimethylation of H3K9.
23539269 Histone H3.3. mutations drive pediatric glioblastoma through upregulation of MYCN.
23523318 Results suggest that histone modification in H3K27 detected using immunohistochemistry can be successfully used as an independent prognostic factor for colorectal cancer patients with metachronous liver metastasis.
23460923 PRAME expression in leukaemic cell lines is upregulated by IFN gamma and LPS, suggesting a possible role in immune responses. Nuclear PRAME interacts with Histone H3, suggesting a role in gene regulation in the nucleus.
23452851 Study shows that H3K4me3-TAF3 interactions direct global TFIID recruitment to active genes, some of which are p53 targets. Further analyses show that H3K4me3 enhances p53-dependent transcription by stimulating preinitiation complex formation.
23376398 histone H3 lysine 79 dimethylation (H3K79me2) and a novel identified site, H2bK5 monomethylation (H2bK5me1), were completely absent in individuals with Neural tube defects
23285239 The SUV39H1 chromodomain was shown to recognize histone H3K9me2/3 specifically.
23281010 Data using recombinant proteins in cell-free lysates suggest that interaction of survivin with phosphorylated histone 3 (H3T3-Phos; a mitotic biological marker appearing during cell division) is abolished by trimethylation at neighboring lysine.
23158102 HIV-1 Rev co-localizes with histone H3 in the nucleoplasmic compartment of cells
23063713 These data suggest that the tandem of plant homeodomain 1/2 fingers play a role in MOZ and MORF histone acetyltransferase association with histon H3 regions enriched in acetylated marks.
22984491 Histone H3 Ser-10 phosphorylation can be designated a new 'apoptotic histone code' mediated by PKCdelta.
22978410 Histone H3 is increased during amino acid response that is associated with active transcription.
22922742 Elongated telomeres show increased trimethylated histone H3 Lys9 (H3K9me3)density.
22853951 17beta-estradiol stimulation induces the recruitment of PAD2 to target promoters by ERalpha, whereby PAD2 then citrullinates H3R26, which leads to local chromatin decondensation and transcriptional activation.
22818287 The levels of H3K4me3 and H3K27me3 show dynamic changes during human oocyte maturation and preimplantation embryonic development.
22713676 Increased levels of decondensed chromatin in both normal progenitor cells and cancer cells are associated with global loss of H3K27me3, which is linked to MYC overexpression.
22371497 O-GlcNAcylation regulates mitosis-specific phosphorylations on H3, providing a mechanistic switch that orchestrates the G2-M transition of the cell cycle.
22360506 our data suggest that global histone H3 and H4 modification patterns are potential markers of tumor recurrence and disease-free survival in non-small cell lung cancer
22228774 HAT1 differentially impacts nucleosome assembly of H3.1-H4 and H3.3-H4.
22099308 NSD2 links dimethylation of histone H3 at lysine 36 to oncogenic programming.
22012064 Studies identified a physical and functional interaction between RUNX1 (AML1) and MLL and show that both are required to maintain the histone lysine 4 trimethyl mark (H3K4me3) at 2 critical regulatory regions of the AML1 target gene PU.1.
21977994 Studies indicate that in Th17 cells, activated STAT3 by IL-6 positively regulates H3K4me3 deposition in the Il17 locus.
21917293 aberration of the global H3K9me2 level is an important epigenetic event in colorectal tumorigenesis and carcinogenesis
21738951 Trimethylation of lysine 27 on histone H3 expression, as examined by immunohistochemistry, has the potential to be used as an immunomarker to predict nasopharyngeal carcinoma chemoradiotherapy response and patient prognosis.
21368055 Deacetylation of histone H3 occurs in the early stages of multiple sclerosis, its efficiency decreasing with disease duration.
21193919 laryngeal cancer is characterized by high proliferative potential mediated by increase in cyclin D1 and H3 mRNAs expression.
20948546 The ataxia telangiectasia, mutated and Rad3-related-Chk1 axis regulates H3-pThr 11 dephosphorylation on DNA damage, at least in part by the activation of PP1gamma through Chk1-dependent inhibition of cyclin dependent kinases.
20841431 Discovery of a subgroup of genes linked to T cell functions displaying high levels of H3K4me2 within their gene body.
20498094 crystal structure of the H3T nucleosome revealed structural differences in the H3T regions on both ends of the central alpha2 helix, as compared to those of H3.1.
20448663 These results suggest that PELP1 is a reader of H3 methylation marks and has a crucial role in modulating the histone code at the ERalpha target genes.
19585526 Dynamic changes in the levels of acetylated, methylated, and phosphorylated histone H3 occur during the initiation of DNA replication at the two human origin loci examined (lamin B2 and hOrs8).
18439419 These results suggest that the histone H3 di-methylation at lysine 9, as well as acetylation at lysine 9/14, may be indispensable for coordinated induction of the GLUT5 gene by p44/42 MAP kinase inhibition and the glucocorticoid hormone.
18418385 Cooperative H3 modification provides a mechanistic basis for GCN5L association with cdk8-Mediator and also identifies a biochemical means by which cdk8 can indirectly activate gene expression.
18281699 Human Nap2 promotes nucleosome assembly with H3t/H4.
18048344 JARID1B was identified as a demethylase capable of removing three methyl groups from histone H3 lysine 4 and up-regulated in prostate cancer.
17320048 Results indicate that single bromodomains bind specific acetyl-lysine sites within the histone 3 tail with sub-micromolar affinity.
17225856 HIV-1 Rev co-localizes with histone H3 in the nucleoplasmic compartment of cells
16354694 These results define H3 phosphorylation as a key to hTERT transactivation induced by proliferation and reveal a fundamental mechanism for telomerase regulation in both normal human cells and transformed T cells.
15611041 HIV-1 Rev co-localizes with histone H3 in the nucleoplasmic compartment of cells
14657027 HIV-1 Rev co-localizes with histone H3 in the nucleoplasmic compartment of cells
11689053 HIV-1 Rev co-localizes with histone H3 in the nucleoplasmic compartment of cells
11080476 HIV-1 Rev co-localizes with histone H3 in the nucleoplasmic compartment of cells
9566873 HIV-1 Rev co-localizes with histone H3 in the nucleoplasmic compartment of cells

AA Sequence

MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR      1 - 70
LMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA         71 - 136
//

Text Mined References (133)

PMID Year Title
26719341 2016 Epigenomic Landscape of Human Fetal Brain, Heart, and Liver.
26669263 2016 EP400 Deposits H3.3 into Promoters and Enhancers during Gene Activation.
26575220 2015 Deciphering H3K4me3 broad domains associated with gene-regulatory networks and conserved epigenomic landscapes in the human brain.
26482474 2016 Histologically distinct neuroepithelial tumors with histone 3 G34 mutation are molecularly similar and comprise a single nosologic entity.
26291278 2015 Coordinated regulation of Nrf2 and histone H3 serine 10 phosphorylation in arsenite-activated transcription of the human heme oxygenase-1 gene.
25712104 2015 H3K4me3 demethylation by the histone demethylase KDM5C/JARID1C promotes DNA replication origin firing.
25696994 2014 [Aberrant expression of sox2 gene in malignant gliomas].
25690891 2015 CHK1-driven histone H3.3 serine 31 phosphorylation is important for chromatin maintenance and cell survival in human ALT cancer cells.
25615412 2015 Human tNASP promotes in vitro nucleosome assembly with histone H3.3.
25560918 2015 The chromodomain-containing histone acetyltransferase TIP60 acts as a code reader, recognizing the epigenetic codes for initiating transcription.
25519907 2015 Dual roles of histone H3 lysine 9 acetylation in human embryonic stem cell pluripotency and neural differentiation.
25519718 2014 Paternal heterochromatin formation in human embryos is H3K9/HP1 directed and primed by sperm-derived histone modifications.
25482197 Distinct chromatin signature of histone H3 variant H3.3 in human cells.
25336637 2014 Reptin and Pontin oligomerization and activity are modulated through histone H3 N-terminal tail interaction.
25281433 2015 Brainstem oligodendroglial tumors in children: two case reports and review of literatures.
25149548 2014 Diffuse large B-cell lymphoma with histone H3 trimethylation at lysine 27: another poor prognostic phenotype independent of c-Myc/Bcl2 coexpression.
24952159 2014 Post-translational modification and mitochondrial relocalization of histone H3 during apoptosis induced by staurosporine.
24744315 2014 Transcriptional regulation of the albumin gene depends on the removal of histone methylation marks by the FAD-dependent monoamine oxidase lysine-specific demethylase 1 in HepG2 human hepatocarcinoma cells.
24656132 2014 A role for H3K4 monomethylation in gene repression and partitioning of chromatin readers.
24614346 2014 Concurrent activation of acetylation and tri-methylation of H3K27 in a subset of hepatocellular carcinoma with aggressive behavior.
24324728 2013 The prognostic value of mitotic activity index (MAI), phosphohistone H3 (PPH3), cyclin B1, cyclin A, and Ki67, alone and in combinations, in node-negative premenopausal breast cancer.
24235145 2014 Automethylation activities within the mixed lineage leukemia-1 (MLL1) core complex reveal evidence supporting a "two-active site" model for multiple histone H3 lysine 4 methylation.
24021213 2013 Phosphohistone H3 and Ki-67 labeling indices in cytologic specimens from well-differentiated neuroendocrine tumors of the gastrointestinal tract and pancreas: a comparative analysis using automated image cytometry.
23954330 2014 The Tudor domain of the PHD finger protein 1 is a dual reader of lysine trimethylation at lysine 36 of histone H3 and lysine 27 of histone variant H3t.
23908241 2013 A role for SIRT2-dependent histone H3K18 deacetylation in bacterial infection.
23582659 2013 Disruption of neocortical histone H3 homeostasis by soluble A?: implications for Alzheimer's disease.
23579270 2013 Menin mediates epigenetic regulation via histone H3 lysine 9 methylation.
23564320 2014 S6 kinase 2 is bound to chromatin-nuclear matrix cellular fractions and is able to phosphorylate histone H3 at threonine 45 in vitro and in vivo.
23541585 2013 Nuclear localization of CPI-17, a protein phosphatase-1 inhibitor protein, affects histone H3 phosphorylation and corresponds to proliferation of cancer and smooth muscle cells.
23541084 2013 Involvement of histone methyltransferase GLP in HIV-1 latency through catalysis of H3K9 dimethylation.
23539269 2013 Histone H3.3. mutations drive pediatric glioblastoma through upregulation of MYCN.
23523318 2013 Global histone modification of H3K27 correlates with the outcomes in patients with metachronous liver metastasis of colorectal cancer.
23460923 2013 PRAME is a golgi-targeted protein that associates with the Elongin BC complex and is upregulated by interferon-gamma and bacterial PAMPs.
23452851 2013 H3K4me3 interactions with TAF3 regulate preinitiation complex assembly and selective gene activation.
23376398 2013 Histone modification mapping in human brain reveals aberrant expression of histone H3 lysine 79 dimethylation in neural tube defects.
23285239 2012 Crystal structure of the human SUV39H1 chromodomain and its recognition of histone H3K9me2/3.
23281010 2013 Examining post-translational modification-mediated protein-protein interactions using a chemical proteomics approach.
23063713 2012 Tandem PHD fingers of MORF/MOZ acetyltransferases display selectivity for acetylated histone H3 and are required for the association with chromatin.
22984491 2012 Apoptotic phosphorylation of histone H3 on Ser-10 by protein kinase C?.
22978410 2013 Dynamic changes in genomic histone association and modification during activation of the ASNS and ATF3 genes by amino acid limitation.
22922742 2012 Telomere length regulates TERRA levels through increased trimethylation of telomeric H3K9 and HP1?.
22853951 2012 Peptidylarginine deiminase 2-catalyzed histone H3 arginine 26 citrullination facilitates estrogen receptor ? target gene activation.
22818287 2012 Dynamic changes of histone H3 trimethylated at positions K4 and K27 in human oocytes and preimplantation embryos.
22713676 2012 Global levels of H3K27me3 track with differentiation in vivo and are deregulated by MYC in prostate cancer.
22371497 2012 ?-N-Acetylglucosamine (O-GlcNAc) is a novel regulator of mitosis-specific phosphorylations on histone H3.
22360506 2012 Global histone modification pattern associated with recurrence and disease-free survival in non-small cell lung cancer patients.
22228774 2012 Human histone acetyltransferase 1 protein preferentially acetylates H4 histone molecules in H3.1-H4 over H3.3-H4.
22099308 2011 NSD2 links dimethylation of histone H3 at lysine 36 to oncogenic programming.
22012064 2011 The ability of MLL to bind RUNX1 and methylate H3K4 at PU.1 regulatory regions is impaired by MDS/AML-associated RUNX1/AML1 mutations.
21977994 2011 Helper T-cell differentiation and plasticity: insights from epigenetics.
21917293 2012 Global histone modification of histone H3 in colorectal cancer and its precursor lesions.
21738951 2011 H3K27me3 protein is a promising predictive biomarker of patients' survival and chemoradioresistance in human nasopharyngeal carcinoma.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21368055 2011 Changed histone acetylation patterns in normal-appearing white matter and early multiple sclerosis lesions.
21193919 2011 Transcriptional activities of histone H3, cyclin D1 and claudin 7 encoding genes in laryngeal cancer.
20948546 2010 Protein phosphatase 1? is responsible for dephosphorylation of histone H3 at Thr 11 after DNA damage.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
20841431 2010 A unique H3K4me2 profile marks tissue-specific gene regulation.
20498094 2010 Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20448663 2010 PELP1 is a reader of histone H3 methylation that facilitates oestrogen receptor-alpha target gene activation by regulating lysine demethylase 1 specificity.
20224553 2010 A cooperative activation loop among SWI/SNF, gamma-H2AX and H3 acetylation for DNA double-strand break repair.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19585526 2009 Dynamic changes in chromatin structure through post-translational modifications of histone H3 during replication origin activation.
19135898 2009 Purification of proteins associated with specific genomic Loci.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18439419 2008 Changes on histone H3 modifications on the GLUT5 gene and its expression in Caco-2 cells co-treated with a p44/42 MAPK inhibitor and glucocorticoid hormone.
18418385 2008 Cooperative activity of cdk8 and GCN5L within Mediator directs tandem phosphoacetylation of histone H3.
18281699 2008 Nucleosome formation with the testis-specific histone H3 variant, H3t, by human nucleosome assembly proteins in vitro.
18048344 2007 JARID1B is a histone H3 lysine 4 demethylase up-regulated in prostate cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17599839 2007 Human SFMBT is a transcriptional repressor protein that selectively binds the N-terminal tail of histone H3.
17567753 2007 Structural basis of the recognition of a methylated histone tail by JMJD2A.
17537733 2007 Structural basis of LSD1-CoREST selectivity in histone H3 recognition.
17320048 2007 Polybromo-1-bromodomains bind histone H3 at specific acetyl-lysine positions.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16354694 2006 Mitogen-activated protein kinase cascade-mediated histone H3 phosphorylation is critical for telomerase reverse transcriptase expression/telomerase activation induced by proliferation.
16166375 2005 Shelterin: the protein complex that shapes and safeguards human telomeres.
16127177 2005 HP1 binds specifically to Lys26-methylated histone H1.4, whereas simultaneous Ser27 phosphorylation blocks HP1 binding.
15922600 2005 Testis-specific histone H3 expression in somatic cells.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15664198 2005 Human Asf1 regulates the flow of S phase histones during replicational stress.
15635413 2005 Nucleolar proteome dynamics.
15620353 2004 Histone demethylation mediated by the nuclear amine oxidase homolog LSD1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15235609 2004 SMYD3 encodes a histone methyltransferase involved in the proliferation of cancer cells.
14993289 2004 Np95 is a histone-binding protein endowed with ubiquitin ligase activity.
14718166 2004 Histone H3.1 and H3.3 complexes mediate nucleosome assembly pathways dependent or independent of DNA synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657027 2003 Regulation of HIV-1 gene expression by histone acetylation and factor recruitment at the LTR promoter.
14633678 2003 Inactivation of a histone methyltransferase by mutations in human cancers.
14594813 2004 Characterization of the protein kinase activity of TRPM7/ChaK1, a protein kinase fused to the transient receptor potential ion channel.
12789342 2003 Histone H3 phosphorylation by IKK-alpha is critical for cytokine-induced gene expression.
12786946 2003 Terminal deoxynucleotidyltransferase forms a ternary complex with a novel chromatin remodeling protein with 82 kDa and core histone.
12773393 2003 MSK2 and MSK1 mediate the mitogen- and stress-induced phosphorylation of histone H3 and HMG-14.
12577067 2003 A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling.
12540855 2003 Structure and catalytic mechanism of the human histone methyltransferase SET7/9.
12514135 2003 Mechanism of histone lysine methyl transfer revealed by the structure of SET7/9-AdoMet.
12489984 2003 Regulation of transcription by the heterogeneous nuclear ribonucleoprotein E1B-AP5 is mediated by complex formation with the novel bromodomain-containing protein BRD7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408966 2002 The human and mouse replication-dependent histone genes.
12389038 2002 The active site of the SET domain is constructed on a knot.
12372304 2002 Crystal structure and functional analysis of the histone methyltransferase SET7/9.
12123582 2002 Methylation of H3-lysine 79 is mediated by a new family of HMTases without a SET domain.
11959841 2002 SETDB1: a novel KAP-1-associated histone H3, lysine 9-specific methyltransferase that contributes to HP1-mediated silencing of euchromatic genes by KRAB zinc-finger proteins.
11864602 2002 Opening of compacted chromatin by early developmental transcription factors HNF3 (FoxA) and GATA-4.
11850410 2002 Set9, a novel histone H3 methyltransferase that facilitates transcription by precluding histone tail modifications required for heterochromatin formation.
11824786 2001 Core histones and linker histones are imported into the nucleus by different pathways.
11779497 2001 Purification and functional characterization of a histone H3-lysine 4-specific methyltransferase.
11689053 2001 Enhancement of the p300 HAT activity by HIV-1 Tat on chromatin DNA.
11602260 2001 Function of nucleophosmin/B23, a nucleolar acidic protein, as a histone chaperone.
11310559 2001 Identification of nuclear-import and cell-cycle regulatory proteins that bind to prothymosin alpha.
11266453 2001 A novel chromatin protein, distantly related to histone H2A, is largely excluded from the inactive X chromosome.
11163245 2001 Regulation of histone acetylation and transcription by INHAT, a human cellular complex containing the set oncoprotein.
11080476 2000 Acetylation of HIV-1 Tat by CBP/P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones.
10926844 2000 Cloning and characterization of a novel human histone deacetylase, HDAC8.
10911985 2000 Synergistic coupling of histone H3 phosphorylation and acetylation in response to epidermal growth factor stimulation.
10523658 1999 The TFIIIC90 subunit of TFIIIC interacts with multiple components of the RNA polymerase III machinery and contains a histone-specific acetyltransferase activity.
10469656 1999 The nucleosomal response associated with immediate-early gene induction is mediated via alternative MAP kinase cascades: MSK1 as a potential histone H3/HMG-14 kinase.
10436156 1999 Requirement of Rsk-2 for epidermal growth factor-activated phosphorylation of histone H3.
10022855 1999 Gadd45, a p53-responsive stress protein, modifies DNA accessibility on damaged chromatin.
9748265 1998 Sequence characteristics, subcellular localization, and substrate specificity of DYRK-related kinases, a novel family of dual specificity protein kinases.
9710638 1998 Core histones and HIRIP3, a novel histone-binding protein, directly interact with WD repeat protein HIRA.
9651585 1998 SAP30, a novel protein conserved between human and yeast, is a component of a histone deacetylase complex.
9566873 1998 Transcriptional activation of the integrated chromatin-associated human immunodeficiency virus type 1 promoter.
9439656 1997 The human histone gene cluster at the D6S105 locus.
9325046 1997 Functional characterization of human nucleosome assembly protein-2 (NAP1L4) suggests a role as a histone chaperone.
8986613 1996 Testis-specific expression of a novel human H3 histone gene.
8980232 1996 The TAF(II)250 subunit of TFIID has histone acetyltransferase activity.
8834248 1996 A solitary human H3 histone gene on chromosome 1.
8798650 1996 Binding of human minichromosome maintenance proteins with histone H3.
3697355 1986 Identification of the core-histone-binding domains of HMG1 and HMG2.