Property Summary

NCBI Gene PubMed Count 25
PubMed Score 4.98
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
22174317 HIV-1 Rev interacting protein, histone 3 H2bb, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa
21362549 ATM-dependent monoubiquitylation of histone H2B is required for timely repair of DNA double-strand breaks
19906922 The present findings provide evidence indicating that the extrachromosomal histone H2B is engaged in the signaling pathway initiated by dsDNA to trigger antiviral innate immune responses.
19834552 USP7 can stimulate EBNA1-DNA interactions and EBNA1 can alter histone modification at oriP through recruitment of USP7.
18958350 infertile men have a higher proportion of spermatozoa with diffuse histone H2B
16878981 Histone H2B represents a regulated plasminogen receptor, which contributes significantly to the plasminogen binding capacity of cells.
14657027 HIV-1 Rev interacting protein, histone 3 H2bb, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa
11689053 HIV-1 Rev interacting protein, histone 3 H2bb, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa
11080476 HIV-1 Rev interacting protein, histone 3 H2bb, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa
9566873 HIV-1 Rev interacting protein, histone 3 H2bb, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa

AA Sequence

MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Text Mined References (28)

PMID Year Title
23824326 2013 USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21362549 2011 Requirement of ATM-dependent monoubiquitylation of histone H2B for timely repair of DNA double-strand breaks.
19906922 2010 Extrachromosomal histone H2B mediates innate antiviral immune responses induced by intracellular double-stranded DNA.
19834552 2009 EBNA1-mediated recruitment of a histone H2B deubiquitylating complex to the Epstein-Barr virus latent origin of DNA replication.
18958350 2008 Sperm nuclear histone H2B: correlation with sperm DNA denaturation and DNA stainability.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16878981 2006 Identification of histone H2B as a regulated plasminogen receptor.
16713563 2006 Histone H2B monoubiquitination functions cooperatively with FACT to regulate elongation by RNA polymerase II.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16627869 2006 Quantitative proteomic analysis of post-translational modifications of human histones.
16319397 2006 Characterization of histone H2A and H2B variants and their post-translational modifications by mass spectrometry.
16307923 2005 Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation.
16283522 2005 Inhibition of core histones acetylation by carcinogenic nickel(II).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15010469 2004 Phosphorylation of histone H2A inhibits transcription on chromatin templates.
14731392 2004 Selective recognition of acetylated histones by bromodomain proteins visualized in living cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657027 2003 Regulation of HIV-1 gene expression by histone acetylation and factor recruitment at the LTR promoter.
12757711 2003 Apoptotic phosphorylation of histone H2B is mediated by mammalian sterile twenty kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408966 2002 The human and mouse replication-dependent histone genes.
11689053 2001 Enhancement of the p300 HAT activity by HIV-1 Tat on chromatin DNA.
11080476 2000 Acetylation of HIV-1 Tat by CBP/P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones.
10469656 1999 The nucleosomal response associated with immediate-early gene induction is mediated via alternative MAP kinase cascades: MSK1 as a potential histone H3/HMG-14 kinase.
9566873 1998 Transcriptional activation of the integrated chromatin-associated human immunodeficiency virus type 1 promoter.