Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
non-small cell lung cancer 1.484 8.4e-12
intraductal papillary-mucinous carcinoma... 1.100 9.1e-04
lung cancer 2.000 1.7e-03
non primary Sjogren syndrome sicca 1.200 1.5e-02
subependymal giant cell astrocytoma -1.194 3.4e-02
lung adenocarcinoma 1.400 1.0e-06
invasive ductal carcinoma 2.500 1.7e-03
Breast cancer 1.600 1.3e-09

 GO Function (1)

Gene RIF (4)

PMID Text
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK               71 - 130
//

Text Mined References (28)

PMID Year Title
25470042 2014 TRIM37 is a new histone H2A ubiquitin ligase and breast cancer oncoprotein.
24352239 2014 Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification.
24140421 2013 VprBP has intrinsic kinase activity targeting histone H2A and represses gene transcription.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22980979 2012 RNF168 ubiquitinates K13-15 on H2A/H2AX to drive DNA damage signaling.
22713238 2012 A novel ubiquitin mark at the N-terminal tail of histone H2As targeted by RNF168 ubiquitin ligase.
22334663 2012 Monoubiquitinated histone H2A destabilizes photolesion-containing nucleosomes with concomitant release of UV-damaged DNA-binding protein E3 ligase.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
19203579 2009 RNF168 binds and amplifies ubiquitin conjugates on damaged chromosomes to allow accumulation of repair proteins.
19203578 2009 The RIDDLE syndrome protein mediates a ubiquitin-dependent signaling cascade at sites of DNA damage.
18001825 2007 RNF8 transduces the DNA-damage signal via histone ubiquitylation and checkpoint protein assembly.
18001824 2007 RNF8 ubiquitylates histones at DNA double-strand breaks and promotes assembly of repair proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16702407 2006 DNA damage triggers nucleotide excision repair-dependent monoubiquitylation of histone H2A.
16359901 2005 Role of Bmi-1 and Ring1A in H2A ubiquitylation and Hox gene silencing.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15823041 2005 Deimination of histone H2A and H4 at arginine 3 in HL-60 granulocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15386022 2004 Role of histone H2A ubiquitination in Polycomb silencing.
15078818 2004 Nucleosomal histone kinase-1 phosphorylates H2A Thr 119 during mitosis in the early Drosophila embryo.
15010469 2004 Phosphorylation of histone H2A inhibits transcription on chromatin templates.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657027 2003 Regulation of HIV-1 gene expression by histone acetylation and factor recruitment at the LTR promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408966 2002 The human and mouse replication-dependent histone genes.
11689053 2001 Enhancement of the p300 HAT activity by HIV-1 Tat on chromatin DNA.
11080476 2000 Acetylation of HIV-1 Tat by CBP/P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones.
9566873 1998 Transcriptional activation of the integrated chromatin-associated human immunodeficiency virus type 1 promoter.