Property Summary

NCBI Gene PubMed Count 94
PubMed Score 144.50
PubTator Score 41.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
acute myeloid leukemia -1.700 2.2e-02
astrocytic glioma -1.200 3.5e-02
astrocytoma -1.200 3.3e-02
Astrocytoma, Pilocytic -1.300 5.1e-03
atypical teratoid / rhabdoid tumor -1.800 2.8e-04
Breast cancer 2.400 4.8e-08
breast carcinoma 1.200 1.3e-04
colon cancer 1.300 1.0e-02
cystic fibrosis 1.309 7.4e-05
diabetes mellitus -1.600 9.6e-03
ductal carcinoma in situ 2.300 8.5e-03
Endometriosis 1.087 2.2e-02
glioblastoma -1.300 1.2e-02
hepatocellular carcinoma 1.100 1.2e-02
inflammatory breast cancer 1.400 2.4e-03
invasive ductal carcinoma 3.600 2.3e-03
lung adenocarcinoma 1.200 5.4e-09
lung cancer 1.200 6.0e-03
lung carcinoma 1.100 1.6e-12
malignant mesothelioma -1.600 7.8e-07
Multiple Sclerosis -1.500 1.6e-03
non-small cell lung carcinoma 1.300 2.6e-19
osteosarcoma 2.916 1.6e-05
pancreatic cancer 2.100 2.1e-04
pancreatic carcinoma 2.100 2.1e-04
Pick disease 1.200 1.2e-05
psoriasis 4.300 2.4e-06
ulcerative colitis -1.537 3.2e-03

PDB (127)

Gene RIF (9)

AA Sequence

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA      1 - 70
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG                                          71 - 103
//

Text Mined References (136)

PMID Year Title