Property Summary

NCBI Gene PubMed Count 76
PubMed Score 138.46
PubTator Score 41.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
hepatocellular carcinoma 1.100 1.2e-02
pancreatic cancer 2.100 2.1e-04
malignant mesothelioma -1.600 7.8e-07
astrocytic glioma -1.200 3.5e-02
psoriasis 4.300 2.4e-06
osteosarcoma 2.916 1.6e-05
cystic fibrosis 1.309 7.4e-05
astrocytoma -1.200 3.3e-02
atypical teratoid / rhabdoid tumor -1.800 2.8e-04
glioblastoma -1.300 1.2e-02
ulcerative colitis -1.537 3.2e-03
lung cancer 1.400 5.1e-05
colon cancer 1.300 1.0e-02
breast carcinoma 1.200 1.3e-04
diabetes mellitus -1.600 9.6e-03
Multiple Sclerosis -1.500 1.6e-03
lung adenocarcinoma 1.200 5.4e-09
pilocytic astrocytoma -1.300 4.3e-03
pancreatic carcinoma 2.100 2.1e-04
Endometriosis 1.087 2.2e-02
inflammatory breast cancer 1.400 2.4e-03
lung carcinoma 1.100 1.6e-12
non-small cell lung carcinoma 1.300 2.6e-19
Pick disease 1.200 1.2e-05
Breast cancer 2.400 4.8e-08
ductal carcinoma in situ 2.300 8.5e-03
invasive ductal carcinoma 3.600 2.3e-03
acute myeloid leukemia -1.700 2.2e-02

Synonym

Accession P62805 A2VCL0 P02304 P02305 Q6DRA9 Q6FGB8 Q6NWP7
Symbols H4
H4/n
H4F2
H4FN
FO108
HIST2H4

Gene

PDB

4Z2M   2RJE   4U9W   5BNX   5BO0   4QUT   4QUU   3QZS   3QZT   3QZV   2IG0   2LVM   2CV5   3A6N   3AFA   3AN2   3AV1   3AV2   3AYW   3AZE   3AZF   3AZG   3AZH   3AZI   3AZJ   3AZK   3AZL   3AZM   3AZN   3W96   3W97   3W98   3W99   3WKJ   3WTP   3X1S   3X1V   4YM5   4YM6   4Z5T   5AV5   5AV6   5AV8   5AV9   5AVB   5AVC   5AY8   5B0Y   5B0Z   5B24   5B2I   5B2J   5B31   5B32   5B40   5CPI   5CPJ   5CPK   3NQJ   3NQU   3R45   3O36   3WAA   4H9N   4H9O   4H9P   4H9Q   4H9R   4H9S   4HGA   5B33   5BNV   5JA4   1ZKK   2BQZ   2KWN   2KWO   2QQS   2RNY   2RS9   3CFS   3CFV   3F9W   3F9X   3F9Y   3F9Z   3IJ1   3JPX   3QBY   3UVW   3UVX   3UVY   3UW9   3WA9   3X1T   3X1U   4GQB   4M38   4N3W   4N4F   4QYD   4YY6   4YYD   4YYG   4YYH   4YYI   4YYJ   4YYK   4YYM   4YYN   5C3I   5FA5   5FFW   5FWE   5KDM  

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (9)

PMID Text
22195965 NASP balances the activity of the heat shock proteins Hsc70 and Hsp90 to direct H3-H4 for degradation by chaperone-mediated autophagy
21994445 H2B and H4 histones were mobilized during herpes simplex virus 1 infection and became available to bind to viral genomes.
19234465 Loss of the H4 arginine 3 methylation mark through short hairpin RNA-mediated knockdown of PRMT5 leads to reduced DNMT3A binding, loss of DNA methylation and gene activation.
15823041 deiminated residues were present in H2A (1-56) and H4 (1-52)
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
12556504 assessed the functional coupling between chromatin organization and regulation of histone H4/n gene expression during HL-60 differentiation into the monocyte/macrophage lineage
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA      1 - 70
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG                                          71 - 103
//

Text Mined References (112)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25615412 2015 Human tNASP promotes in vitro nucleosome assembly with histone H3.3.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25416956 2014 A proteome-scale map of the human interactome network.
25281266 2014 Structural insights into recognition of acetylated histone ligands by the BRPF1 bromodomain.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24699735 2014 Structure of human nucleosome containing the testis-specific histone variant TSH2B.
24596249 2014 Molecular functions of the TLE tetramerization domain in Wnt target gene repression.
24525235 2014 Disrupting the interaction of BRD4 with diacetylated Twist suppresses tumorigenesis in basal-like breast cancer.
24360279 2013 Brd4 and JMJD6-associated anti-pause enhancers in regulation of transcriptional pause release.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24183680 2013 Reduced H3K27me3 and DNA hypomethylation are major drivers of gene expression in K27M mutant pediatric high-grade gliomas.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23831576 2013 The CH2 domain of CBP/p300 is a novel zinc finger.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22373579 2012 RNF8- and RNF168-dependent degradation of KDM4A/JMJD2A triggers 53BP1 recruitment to DNA damage sites.
22368283 2012 Human PIH1 associates with histone H4 to mediate the glucose-dependent enhancement of pre-rRNA synthesis.
22195965 2011 A specific function for the histone chaperone NASP to fine-tune a reservoir of soluble H3-H4 in the histone supply chain.
21994445 2011 Core histones H2B and H4 are mobilized during infection with herpes simplex virus 1.
21983900 2012 SET8 promotes epithelial-mesenchymal transition and confers TWIST dual transcriptional activities.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21724829 2011 Phosphorylation of H4 Ser 47 promotes HIRA-mediated nucleosome assembly.
21636898 2011 Structures of human nucleosomes containing major histone H3 variants.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21596426 2011 Recognition of a mononucleosomal histone modification pattern by BPTF via multivalent interactions.
21478274 2011 Structure of a CENP-A-histone H4 heterodimer in complex with chaperone HJURP.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20951943 2010 Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase.
20709061 2010 Structural implications for K5/K12-di-acetylated histone H4 recognition by the second bromodomain of BRD2.
20618440 2010 Proteomic and biochemical analysis of 14-3-3-binding proteins during C2-ceramide-induced apoptosis.
20498094 2010 Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19862764 2009 Analysis of interaction partners of H4 histone by a new proteomics approach.
19818714 2009 BBAP monoubiquitylates histone H4 at lysine 91 and selectively modulates the DNA damage response.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19498464 2009 The HP1alpha-CAF1-SetDB1-containing complex provides H3K9me1 for Suv39-mediated K9me3 in pericentric heterochromatin.
19494831 2009 Molecular recognition of histone lysine methylation by the Polycomb group repressor dSfmbt.
19410544 2009 Centromere-specific assembly of CENP-a nucleosomes is mediated by HJURP.
19234465 2009 PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19135898 2009 Purification of proteins associated with specific genomic Loci.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18474616 2008 PR-Set7 establishes a repressive trans-tail histone code that regulates differentiation.
18408754 2008 Histone H4 lysine 20 monomethylation promotes transcriptional repression by L3MBTL1.
18404153 2008 The histone-binding protein COPR5 is required for nuclear functions of the protein arginine methyltransferase PRMT5.
17967882 2008 Certain and progressive methylation of histone H4 at lysine 20 during the cell cycle.
17675446 2007 A charge-based interaction between histone H4 and Dot1 is required for H3K79 methylation and telomere silencing: identification of a new trans-histone pathway.
17540172 2007 L3MBTL1, a histone-methylation-dependent chromatin lock.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16917504 2006 The N-CoR complex enables chromatin remodeler SNF2H to enhance repression by thyroid hormone receptor.
16678110 2006 Histone H3 and H4 ubiquitylation by the CUL4-DDB-ROC1 ubiquitin ligase facilitates cellular response to DNA damage.
16567635 2006 Structural basis for histone N-terminal recognition by human peptidylarginine deiminase 4.
16415788 2006 Tudor, MBT and chromo domains gauge the degree of lysine methylation.
15964846 2005 SET8 recognizes the sequence RHRK20VLRDN within the N terminus of histone H4 and mono-methylates lysine 20.
15951514 2005 Alteration of the nucleosomal DNA path in the crystal structure of a human nucleosome core particle.
15933069 2005 Specificity and mechanism of the histone methyltransferase Pr-Set7.
15823041 2005 Deimination of histone H2A and H4 at arginine 3 in HL-60 granulocytes.
15670829 2005 Identification of proteins interacting with the RNAPII FCP1 phosphatase: FCP1 forms a complex with arginine methyltransferase PRMT5 and it is a substrate for PRMT5-mediated methylation.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15527963 2004 Functional characterization of a human histone gene cluster duplication.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345777 2004 Human PAD4 regulates histone arginine methylation levels via demethylimination.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
14993289 2004 Np95 is a histone-binding protein endowed with ubiquitin ligase activity.
14718166 2004 Histone H3.1 and H3.3 complexes mediate nucleosome assembly pathways dependent or independent of DNA synthesis.
14657027 2003 Regulation of HIV-1 gene expression by histone acetylation and factor recruitment at the LTR promoter.
14595808 2003 Identification of chromatin-related protein interactions using protein microarrays.
14585971 2003 Identification of HiNF-P, a key activator of cell cycle-controlled histone H4 genes at the onset of S phase.
14578449 2003 Histone sumoylation is associated with transcriptional repression.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12861021 2003 Acetylation-dependent chromatin reorganization by BRDT, a testis-specific bromodomain-containing protein.
12628926 2003 Purification and functional characterization of the human N-CoR complex: the roles of HDAC3, TBL1 and TBLR1.
12556504 2003 Maintenance of open chromatin and selective genomic occupancy at the cell cycle-regulated histone H4 promoter during differentiation of HL-60 promyelocytic leukemia cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414651 2002 Characterization of t(3;6)(q27;p21) breakpoints in B-cell non-Hodgkin's lymphoma and construction of the histone H4/BCL6 fusion gene, leading to altered expression of Bcl-6.
12408966 2002 The human and mouse replication-dependent histone genes.
12086618 2002 PR-Set7 is a nucleosome-specific methyltransferase that modifies lysine 20 of histone H4 and is associated with silent chromatin.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11689053 2001 Enhancement of the p300 HAT activity by HIV-1 Tat on chromatin DNA.
11448779 2001 Methylation of histone H4 at arginine 3 occurs in vivo and is mediated by the nuclear receptor coactivator PRMT1.
11387442 2001 Methylation of histone H4 at arginine 3 facilitating transcriptional activation by nuclear hormone receptor.
11163245 2001 Regulation of histone acetylation and transcription by INHAT, a human cellular complex containing the set oncoprotein.
11080476 2000 Acetylation of HIV-1 Tat by CBP/P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones.
10220385 1999 Three proteins define a class of human histone deacetylases related to yeast Hda1p.
10096020 1998 Tip60 acetylates six lysines of a specific class in core histones in vitro.
9566873 1998 Transcriptional activation of the integrated chromatin-associated human immunodeficiency virus type 1 promoter.
9540062 1998 The integrated activities of IRF-2 (HiNF-M), CDP/cut (HiNF-D) and H4TF-2 (HiNF-P) regulate transcription of a cell cycle controlled human histone H4 gene: mechanistic differences between distinct H4 genes.
9439656 1997 The human histone gene cluster at the D6S105 locus.
9325046 1997 Functional characterization of human nucleosome assembly protein-2 (NAP1L4) suggests a role as a histone chaperone.
9119399 1997 Human histone gene organization: nonregular arrangement within a large cluster.
9031620 1997 Characterization of the H1.5 gene completes the set of human H1 subtype genes.
8988030 1997 A recurring translocation, t(3;6)(q27;p21), in non-Hodgkin's lymphoma results in replacement of the 5' regulatory region of BCL6 with a novel H4 histone gene.
8814229 1996 Prothymosin alpha binds histones in vitro and shows activity in nucleosome assembly assay.
7675449 1995 Constitutive phosphorylation of Shc proteins in human tumors.
7664735 1995 Histone H4 acetylation distinguishes coding regions of the human genome from heterochromatin in a differentiation-dependent but transcription-independent manner.
7626218 1995 Association of histone H4 genes with the mammalian testis-specific H1t histone gene.
6494913 1984 A major human histone gene cluster on the long arm of chromosome 1.
6314274 1983 Structure and in vitro transcription of a human H4 histone gene.
3340182 1988 A highly basic histone H4 domain bound to the sharply bent region of nucleosomal DNA.
3035717 1987 Protein-DNA interactions in vivo upstream of a cell cycle-regulated human H4 histone gene.
2474456 1989 Histone H4 acetylation in human cells. Frequency of acetylation at different sites defined by immunolabeling with site-specific antibodies.
1916825 1991 Isolation and characterization of two human H1 histone genes within clusters of core histone genes.