Property Summary

NCBI Gene PubMed Count 12
PubMed Score 12.67
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
pulmonary tuberculosis 9 3.228 1.6

Expression

PDB (19)

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR      1 - 70
LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA         71 - 136
//

Text Mined References (53)

PMID Year Title