Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.41
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
pulmonary tuberculosis 8 3.206 1.6

Expression

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR      1 - 70
LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA         71 - 136
//

Text Mined References (46)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25615412 2015 Human tNASP promotes in vitro nucleosome assembly with histone H3.3.
23415232 2013 Regulation of transcription through acetylation of H3K122 on the lateral surface of the histone octamer.
22483618 2012 Lysyl oxidase-like 2 deaminates lysine 4 in histone H3.
22387026 2012 Histone H3 lysine 56 methylation regulates DNA replication through its interaction with PCNA.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21636898 2011 Structures of human nucleosomes containing major histone H3 variants.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21596426 2011 Recognition of a mononucleosomal histone modification pattern by BPTF via multivalent interactions.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
20580717 2010 Loss of a DNA binding site within the tail of prelamin A contributes to altered heterochromatin anchorage by progerin.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20228790 2010 Phosphorylation of histone H3T6 by PKCbeta(I) controls demethylation at histone H3K4.
19783980 2009 JAK2 phosphorylates histone H3Y41 and excludes HP1alpha from chromatin.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19520870 2009 Acetylation of histone H3 at the nucleosome dyad alters DNA-histone binding.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18079182 2007 PRMT6-mediated methylation of R2 in histone H3 antagonizes H3 K4 trimethylation.
18077460 2008 Arginine methylation of the histone H3 tail impedes effector binding.
18066052 2008 Phosphorylation of histone H3 at threonine 11 establishes a novel chromatin mark for transcriptional regulation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17898714 2007 Methylation of histone H3R2 by PRMT6 and H3K4 by an MLL complex are mutually exclusive.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17292837 2007 Structure of the histone chaperone ASF1 bound to the histone H3 C-terminal helix and functional insights.
17194708 2007 Organismal differences in post-translational modifications in histones H3 and H4.
17189264 2007 Identification of histone H3 lysine 36 acetylation as a highly conserved histone modification.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16678110 2006 Histone H3 and H4 ubiquitylation by the CUL4-DDB-ROC1 ubiquitin ligase facilitates cellular response to DNA damage.
16627869 2006 Quantitative proteomic analysis of post-translational modifications of human histones.
16567635 2006 Structural basis for histone N-terminal recognition by human peptidylarginine deiminase 4.
16497732 2006 Coactivator-associated arginine methyltransferase-1 enhances nuclear factor-kappaB-mediated gene transcription through methylation of histone H3 at arginine 17.
16267050 2006 Expression patterns and post-translational modifications associated with mammalian histone H3 variants.
16185088 2005 Modifications of human histone H3 variants during mitosis.
15684425 2005 Phosphorylation of Ser28 in histone H3 mediated by mixed lineage kinase-like mitogen-activated protein triple kinase alpha.
15681610 2005 The kinase haspin is required for mitotic histone H3 Thr 3 phosphorylation and normal metaphase chromosome alignment.
15527963 2004 Functional characterization of a human histone gene cluster duplication.
15525939 2004 Methylated lysine 79 of histone H3 targets 53BP1 to DNA double-strand breaks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471871 2004 Ligand-dependent activation of the farnesoid X-receptor directs arginine methylation of histone H3 by CARM1.
15345777 2004 Human PAD4 regulates histone arginine methylation levels via demethylimination.
12560483 2003 Novel mitosis-specific phosphorylation of histone H3 at Thr11 mediated by Dlk/ZIP kinase.
12408966 2002 The human and mouse replication-dependent histone genes.
11856369 2002 Aurora-B phosphorylates Histone H3 at serine28 with regard to the mitotic chromosome condensation.
11242053 2001 Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins.
10464286 1999 Identification of a novel phosphorylation site on histone H3 coupled with mitotic chromosome condensation.
7309716 1981 Human spleen histone H3. Isolation and amino acid sequence.