Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non-small cell lung carcinoma 317 2.6e-16
lung carcinoma 2843 6.9e-10
lung adenocarcinoma 2716 1.9e-08

Expression

AA Sequence

MPEPAKFAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKRVHPDTGIWCKAMGIMNSFLNDI      1 - 70
FERIAGEASRLAHYNKRSTITSRRSRRPCACCCPASWPSTPCPRAPRRSPSTPAPSESLPGPGARSLPPS     71 - 140
LPPRVAGCFVSKGSFQGHLTPLVK                                                  141 - 164
//

Text Mined References (13)

PMID Year Title