Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.28
PubTator Score 3.93

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.900 7.3e-08
breast carcinoma 1.400 1.5e-03
diabetes mellitus -1.200 2.8e-03
lung adenocarcinoma 1.800 1.9e-07
non-small cell lung carcinoma 1.200 1.4e-19

Gene RIF (5)

AA Sequence

MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGKNK               71 - 130
//

Text Mined References (33)

PMID Year Title