Property Summary

NCBI Gene PubMed Count 59
PubMed Score 6.95
PubTator Score 4.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.400 8.8e-07
Breast cancer 2.400 4.6e-09
breast carcinoma 1.100 4.2e-02
colon cancer 2.000 2.5e-04
cutaneous lupus erythematosus 2.000 9.4e-04
cystic fibrosis 1.334 4.5e-05
ductal carcinoma in situ 1.700 4.8e-03
gastric cancer -1.200 2.3e-02
glioblastoma 1.200 6.4e-04
hepatocellular carcinoma 1.900 7.1e-05
inflammatory breast cancer 1.600 5.7e-04
intraductal papillary-mucinous carcinoma... 1.300 1.5e-02
intraductal papillary-mucinous neoplasm ... 2.800 3.8e-05
invasive ductal carcinoma 3.200 1.7e-03
lung adenocarcinoma 1.200 1.1e-08
lung cancer 1.900 5.8e-04
lung carcinoma -1.800 7.5e-13
malignant mesothelioma 2.600 9.7e-06
medulloblastoma, large-cell 2.100 5.3e-05
non-small cell lung cancer 1.138 2.4e-09
non-small cell lung carcinoma 1.200 8.7e-18
osteosarcoma 1.458 9.5e-07
ovarian cancer 1.200 1.6e-11
pancreatic cancer 3.200 1.6e-04
pancreatic carcinoma 3.200 1.6e-04
pediatric high grade glioma 1.500 8.2e-06
psoriasis -3.700 7.9e-05
sonic hedgehog group medulloblastoma 1.300 4.3e-02
spina bifida -2.578 3.9e-02
tuberculosis -1.200 1.3e-03

PDB (184)

Gene RIF (6)

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR      1 - 70
LVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA         71 - 136
//

Text Mined References (109)

PMID Year Title