Property Summary

NCBI Gene PubMed Count 53
PubMed Score 6.38
PubTator Score 4.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
gastric cancer -1.200 2.3e-02
hepatocellular carcinoma 1.900 7.1e-05
pancreatic cancer 3.200 1.6e-04
malignant mesothelioma 2.600 9.7e-06
cutaneous lupus erythematosus 2.000 9.4e-04
psoriasis -3.700 7.9e-05
osteosarcoma 1.458 9.5e-07
glioblastoma 1.700 1.7e-04
cystic fibrosis 1.334 4.5e-05
atypical teratoid / rhabdoid tumor 2.400 8.8e-07
medulloblastoma, large-cell 2.100 5.3e-05
tuberculosis -1.200 1.3e-03
non-small cell lung carcinoma 1.300 5.8e-16
intraductal papillary-mucinous carcinoma... 1.300 1.5e-02
intraductal papillary-mucinous neoplasm ... 2.800 3.8e-05
lung cancer 3.300 1.0e-06
colon cancer 2.000 2.5e-04
breast carcinoma 1.100 4.2e-02
lung adenocarcinoma 1.500 1.4e-12
pediatric high grade glioma 1.500 8.2e-06
sonic hedgehog group medulloblastoma 1.300 4.3e-02
pancreatic carcinoma 3.200 1.6e-04
Breast cancer 2.400 4.6e-09
inflammatory breast cancer 2.300 2.5e-05
lung carcinoma -1.800 7.5e-13
spina bifida -2.578 3.9e-02
ductal carcinoma in situ 1.700 4.8e-03
invasive ductal carcinoma 3.200 1.7e-03
ovarian cancer 1.200 1.6e-11

Gene

PDB

3RIG   3RIY   4F4U   4F56   2UXN   3A1B   4QBQ   4QBR   4QBS   2M0O   4Z0R   4L7X   4Z2M   2L75   2VPG   4UP0   5HJB   5HJD   1O9S   2RI7   3U5N   3U5O   3U5P   2CV5   3AFA   3AYW   3AZE   3AZF   3AZG   3AZH   3AZI   3AZJ   3AZK   3AZL   3AZM   3AZN   3W96   3W97   3W98   3W99   3WKJ   3X1S   3X1V   4YM5   4YM6   5AV5   5AV6   5AV8   5AV9   5AVB   5AVC   5B24   5B2I   5B2J   5B31   5CPI   5CPJ   5CPK   2C1J   2C1N   3SOU   3SOW   3ZVY   5IQL   4LXL   3O34   3O35   3O37   3WAA   4FWF   4HON   3WA9   3X1T   3X1U   5C3I   3AVR   2OQ6   2OT7   2OX0   3U4S   5D6Y   3KQI   3UEE   3UEF   3UIG   3UII   3UIK   4A0J   4A0N   5C13   4A7J   5HYN   3QJ6   2B2T   2B2U   2B2V   2B2W   5FB0   5FB1   2LBM   5HJC   3B95   4I51   3V43   4LK9   4LKA   4LLB   2KWJ   2KWK   4BD3   5FFV   4UY4   5T1G   3LQI   3LQJ   5DAH   1CS9   1CT6   1Q3L   3KMT   3U31   3U3D   3ZG6   4C1Q   4N4H   4TN7   4U68   4X3K   4YHP   4YHZ   5C11   5CH1   5CH2   5JHN   5JIN   5JJ0   5T1I  

Gene RIF (6)

PMID Text
20213041 These results uncover a novel role of CENP-F in regulation of epigenetic modification on histone H3.
20089855 CREB controls MSK1-mediated phosphorylation of histone H3 at the c-fos promoter in vitro
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR      1 - 70
LVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA         71 - 136
//

Text Mined References (94)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25615412 2015 Human tNASP promotes in vitro nucleosome assembly with histone H3.3.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24788516 2014 Structural analysis of the KANSL1/WDR5/KANSL2 complex reveals that WDR5 is required for efficient assembly and chromatin targeting of the NSL complex.
24699735 2014 Structure of human nucleosome containing the testis-specific histone variant TSH2B.
24606918 2014 SAICAR induces protein kinase activity of PKM2 that is necessary for sustained proliferative signaling of cancer cells.
23415232 2013 Regulation of transcription through acetylation of H3K122 on the lateral surface of the histone octamer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22483618 2012 Lysyl oxidase-like 2 deaminates lysine 4 in histone H3.
22387026 2012 Histone H3 lysine 56 methylation regulates DNA replication through its interaction with PCNA.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21685874 2011 Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
21636898 2011 Structures of human nucleosomes containing major histone H3 variants.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20871592 2010 Methyl-H3K9-binding protein MPP8 mediates E-cadherin gene silencing and promotes tumour cell motility and invasion.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
20541251 2010 Pro isomerization in MLL1 PHD3-bromo cassette connects H3K4me readout to CyP33 and HDAC-mediated repression.
20498094 2010 Structural basis of instability of the nucleosome containing a testis-specific histone variant, human H3T.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20228790 2010 Phosphorylation of histone H3T6 by PKCbeta(I) controls demethylation at histone H3K4.
20213041 2010 Involvement of CENP-F in histone methylation.
20089855 2010 cAMP-response element-binding protein (CREB) controls MSK1-mediated phosphorylation of histone H3 at the c-fos promoter in vitro.
19946888 2010 Defining the membrane proteome of NK cells.
19783980 2009 JAK2 phosphorylates histone H3Y41 and excludes HP1alpha from chromatin.
19766566 2009 Histone crosstalk between H3S10ph and H4K16ac generates a histone code that mediates transcription elongation.
19520870 2009 Acetylation of histone H3 at the nucleosome dyad alters DNA-histone binding.
19498464 2009 The HP1alpha-CAF1-SetDB1-containing complex provides H3K9me1 for Suv39-mediated K9me3 in pericentric heterochromatin.
19410544 2009 Centromere-specific assembly of CENP-a nucleosomes is mediated by HJURP.
19135898 2009 Purification of proteins associated with specific genomic Loci.
18418070 2008 Modulation of 14-3-3 interaction with phosphorylated histone H3 by combinatorial modification patterns.
18292755 2008 The autoimmune regulator PHD finger binds to non-methylated histone H3K4 to activate gene expression.
18243098 2008 Chk1 is a histone H3 threonine 11 kinase that regulates DNA damage-induced transcriptional repression.
18079182 2007 PRMT6-mediated methylation of R2 in histone H3 antagonizes H3 K4 trimethylation.
18077460 2008 Arginine methylation of the histone H3 tail impedes effector binding.
18066052 2008 Phosphorylation of histone H3 at threonine 11 establishes a novel chromatin mark for transcriptional regulation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17898714 2007 Methylation of histone H3R2 by PRMT6 and H3K4 by an MLL complex are mutually exclusive.
17675446 2007 A charge-based interaction between histone H4 and Dot1 is required for H3K79 methylation and telomere silencing: identification of a new trans-histone pathway.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17194708 2007 Organismal differences in post-translational modifications in histones H3 and H4.
17189264 2007 Identification of histone H3 lysine 36 acetylation as a highly conserved histone modification.
17157298 2006 Solution structure and NMR characterization of the binding to methylated histone tails of the plant homeodomain finger of the tumour suppressor ING4.
16946699 2006 Structural basis for molecular recognition and presentation of histone H3 by WDR5.
16678110 2006 Histone H3 and H4 ubiquitylation by the CUL4-DDB-ROC1 ubiquitin ligase facilitates cellular response to DNA damage.
16627869 2006 Quantitative proteomic analysis of post-translational modifications of human histones.
16603238 2006 Reversal of histone lysine trimethylation by the JMJD2 family of histone demethylases.
16567635 2006 Structural basis for histone N-terminal recognition by human peptidylarginine deiminase 4.
16497732 2006 Coactivator-associated arginine methyltransferase-1 enhances nuclear factor-kappaB-mediated gene transcription through methylation of histone H3 at arginine 17.
16457588 2006 Mass spectrometric characterization of human histone H3: a bird's eye view.
16415881 2006 Structural basis for the methylation site specificity of SET7/9.
16415788 2006 Tudor, MBT and chromo domains gauge the degree of lysine methylation.
16372014 2005 Double chromodomains cooperate to recognize the methylated histone H3 tail.
16267050 2006 Expression patterns and post-translational modifications associated with mammalian histone H3 variants.
16246723 2005 Molecular basis for the recognition of phosphorylated and phosphoacetylated histone h3 by 14-3-3.
16185088 2005 Modifications of human histone H3 variants during mitosis.
15983376 2005 Protein identification using sequential ion/ion reactions and tandem mass spectrometry.
15951514 2005 Alteration of the nucleosomal DNA path in the crystal structure of a human nucleosome core particle.
15684425 2005 Phosphorylation of Ser28 in histone H3 mediated by mixed lineage kinase-like mitogen-activated protein triple kinase alpha.
15681610 2005 The kinase haspin is required for mitotic histone H3 Thr 3 phosphorylation and normal metaphase chromosome alignment.
15525939 2004 Methylated lysine 79 of histone H3 targets 53BP1 to DNA double-strand breaks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471871 2004 Ligand-dependent activation of the farnesoid X-receptor directs arginine methylation of histone H3 by CARM1.
15345777 2004 Human PAD4 regulates histone arginine methylation levels via demethylimination.
14993289 2004 Np95 is a histone-binding protein endowed with ubiquitin ligase activity.
14718166 2004 Histone H3.1 and H3.3 complexes mediate nucleosome assembly pathways dependent or independent of DNA synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657027 2003 Regulation of HIV-1 gene expression by histone acetylation and factor recruitment at the LTR promoter.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12823900 2003 Aberrant expression pattern of replication-dependent histone h3 subtype genes in human tumor cell lines.
12560483 2003 Novel mitosis-specific phosphorylation of histone H3 at Thr11 mediated by Dlk/ZIP kinase.
12540855 2003 Structure and catalytic mechanism of the human histone methyltransferase SET7/9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408966 2002 The human and mouse replication-dependent histone genes.
11856369 2002 Aurora-B phosphorylates Histone H3 at serine28 with regard to the mitotic chromosome condensation.
11791185 2002 Molecular cloning of ESET, a novel histone H3-specific methyltransferase that interacts with ERG transcription factor.
11689053 2001 Enhancement of the p300 HAT activity by HIV-1 Tat on chromatin DNA.
11242053 2001 Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins.
11080476 2000 Acetylation of HIV-1 Tat by CBP/P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones.
10975519 2000 Mitotic phosphorylation of histone H3 is governed by Ipl1/aurora kinase and Glc7/PP1 phosphatase in budding yeast and nematodes.
10949293 2000 Regulation of chromatin structure by site-specific histone H3 methyltransferases.
10464286 1999 Identification of a novel phosphorylation site on histone H3 coupled with mitotic chromosome condensation.
9566873 1998 Transcriptional activation of the integrated chromatin-associated human immunodeficiency virus type 1 promoter.
9439656 1997 The human histone gene cluster at the D6S105 locus.
9119399 1997 Human histone gene organization: nonregular arrangement within a large cluster.
9031620 1997 Characterization of the H1.5 gene completes the set of human H1 subtype genes.
8227173 1993 Association of a human H1 histone gene with an H2A pseudogene and genes encoding H2B.1 and H3.1 histones.
7309716 1981 Human spleen histone H3. Isolation and amino acid sequence.
6647026 1983 The primary structure and expression of four cloned human histone genes.
3013246 1986 Enhancer-facilitated expression of prokaryotic and eukaryotic genes using human histone gene 5' regulatory sequences.
1916825 1991 Isolation and characterization of two human H1 histone genes within clusters of core histone genes.