Property Summary

NCBI Gene PubMed Count 22
PubMed Score 0.40
PubTator Score 12.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 3.0
Disease Target Count Z-score Confidence
Retinitis pigmentosa 11 59 3.764 1.9

Expression

Gene RIF (6)

AA Sequence

MPELAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Text Mined References (34)

PMID Year Title