Property Summary

NCBI Gene PubMed Count 24
PubMed Score 0.51
PubTator Score 3.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

 GO Function (1)

 GO Process (1)

Protein-protein Interaction (15)

Gene RIF (6)

PMID Text
22174317 HIV-1 Rev interacting protein, histone cluster 1, H2bb (HIST1H2BB), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
21362548 RNF20-mediated H2B ubiquitination at DSBs plays a critical role in HRR through chromatin remodeling
14657027 HIV-1 Rev interacting protein, histone cluster 1, H2bb (HIST1H2BB), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11689053 HIV-1 Rev interacting protein, histone cluster 1, H2bb (HIST1H2BB), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11080476 HIV-1 Rev interacting protein, histone cluster 1, H2bb (HIST1H2BB), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9566873 HIV-1 Rev interacting protein, histone cluster 1, H2bb (HIST1H2BB), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Text Mined References (28)

PMID Year Title
23824326 2013 USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21362548 2011 Regulation of homologous recombination by RNF20-dependent H2B ubiquitination.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19135898 2009 Purification of proteins associated with specific genomic Loci.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16713563 2006 Histone H2B monoubiquitination functions cooperatively with FACT to regulate elongation by RNA polymerase II.
16319397 2006 Characterization of histone H2A and H2B variants and their post-translational modifications by mass spectrometry.
16307923 2005 Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation.
16283522 2005 Inhibition of core histones acetylation by carcinogenic nickel(II).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14993289 2004 Np95 is a histone-binding protein endowed with ubiquitin ligase activity.
14657027 2003 Regulation of HIV-1 gene expression by histone acetylation and factor recruitment at the LTR promoter.
12757711 2003 Apoptotic phosphorylation of histone H2B is mediated by mammalian sterile twenty kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408966 2002 The human and mouse replication-dependent histone genes.
11709551 2002 Global regulation of post-translational modifications on core histones.
11689053 2001 Enhancement of the p300 HAT activity by HIV-1 Tat on chromatin DNA.
11080476 2000 Acetylation of HIV-1 Tat by CBP/P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones.
9566873 1998 Transcriptional activation of the integrated chromatin-associated human immunodeficiency virus type 1 promoter.
9439656 1997 The human histone gene cluster at the D6S105 locus.
9149941 1997 A 1.1-Mb transcript map of the hereditary hemochromatosis locus.
9119399 1997 Human histone gene organization: nonregular arrangement within a large cluster.
8227173 1993 Association of a human H1 histone gene with an H2A pseudogene and genes encoding H2B.1 and H3.1 histones.
1916825 1991 Isolation and characterization of two human H1 histone genes within clusters of core histone genes.