Property Summary

NCBI Gene PubMed Count 21
PubMed Score 41.36
PubTator Score 9.50

Knowledge Summary

Patent

No data available

 GO Function (1)

 HCA RNA Cell Line (1)

Gene RIF (6)

PMID Text
26759222 Data show that histone H2B of prostate cancer cell line DU-145 have hypoacetylation, hypomethylation, and dephosphorylation, suggesting there was an excessive histone deacetylase activity in the cells.
15709765 Reconstituted TSH2B containing octamers are able to form nucleosome core particles which are structurally and dynamically indistinguishable from those reconstituted with octamers consisting of only native histones.
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTD      1 - 70
IFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                  71 - 127
//

Text Mined References (25)

PMID Year Title
26759222 2016 Hypoacetylation, hypomethylation, and dephosphorylation of H2B histones and excessive histone deacetylase activity in DU-145 prostate cancer cells.
26649967 2016 Two Histone Variants TH2A and TH2B Enhance Human Induced Pluripotent Stem Cell Generation.
24699735 2014 Structure of human nucleosome containing the testis-specific histone variant TSH2B.
24614311 2014 Every amino acid matters: essential contributions of histone variants to mammalian development and disease.
23884607 2013 Chromatin-to-nucleoprotamine transition is controlled by the histone H2B variant TH2B.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21249133 2011 Histone variants and their post-translational modifications in primary human fat cells.
19135898 2009 Purification of proteins associated with specific genomic Loci.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16713563 2006 Histone H2B monoubiquitination functions cooperatively with FACT to regulate elongation by RNA polymerase II.
16307923 2005 Monoubiquitination of human histone H2B: the factors involved and their roles in HOX gene regulation.
16283522 2005 Inhibition of core histones acetylation by carcinogenic nickel(II).
15709765 2005 Characterization of nucleosomes consisting of the human testis/sperm-specific histone H2B variant (hTSH2B).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657027 2003 Regulation of HIV-1 gene expression by histone acetylation and factor recruitment at the LTR promoter.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408966 2002 The human and mouse replication-dependent histone genes.
12213818 2002 Human testis/sperm-specific histone H2B (hTSH2B). Molecular cloning and characterization.
11689053 2001 Enhancement of the p300 HAT activity by HIV-1 Tat on chromatin DNA.
11080476 2000 Acetylation of HIV-1 Tat by CBP/P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones.
9566873 1998 Transcriptional activation of the integrated chromatin-associated human immunodeficiency virus type 1 promoter.