1. Home
  2. Targets
  3. nucleic acid binding
  4. DNA binding protein
  5. histone
  6. Histone H2B type 1-A

Tbio Histone H2B type 1-A

Variant histone specifically required to direct the transformation of dissociating nucleosomes to protamine in male germ cells (By similarity). Entirely replaces classical histone H2B prior nucleosome to protamine transition and probably acts as a nucleosome dissociating factor that creates a more dynamic chromatin, facilitating the large-scale exchange of histones (By similarity). Core component of nucleosome (By similarity). Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template (By similarity). Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability (By similarity). DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling (By similarity). Also found in fat cells, its function and the presence of post-translational modifications specific to such cells are still unclear (PubMed:21249133).

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a testis/sperm-specific member of the histone H2B family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq, Aug 2015]

 Comments

Property Summary

NCBI Gene PubMed Count 24
PubMed Score 45.49
PubTator Score 9.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

Synonym

Accession Q96A08 B2R544 Q6NZ98 Q6NZA0 Q6NZA1
Symbols STBP
TH2B
H2BFU
TSH2B
hTSH2B
TSH2B.1
bA317E16.3

Gene

HIST1H2BA

PANTHER Protein Class (3)

PDB

5GSU   3WKJ   5GT3  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

 UniProt Keyword (12)

See all...

 GO Function (3)

 GO Component (6)

 GO Process (8)

 Compartment GO Term (27)

See all...

 HCA RNA Cell Line (1)

Pathway (81)

See all...

Protein-protein Interaction (69)

NAP1L1   NAP1L4   RUVBL1   MIER1   HDAC1   HDAC2   EP400   GON4L   MEAF6   H2AFY2   H2AFY   SUPT16H   LIG3   ACTL6A   ACTL6B   EPC1   EPC2   PARP2   PHF14   PARP1   SRCAP   DMAP1   TCF20   ARID5B   TRRAP   C16orf87   HLTF   MCM7   MCM2   IPO9   BRD8   HIST1H1T   PPM1G   VPS72   EHMT2   HIST1H2BL   MMS22L   MCM6   SSRP1   ING3   H2AFZ   HIST1H2AG   HIST2H2AB   TEX10   BAHD1   MIER3   RUVBL2   CRAMP1   ANP32E   MCM4   ACTR6   XPC   CFDP1   KAT5   CETN2   UBE2O   MBTD1   MORF4L1   MRGBP   TONSL   CDYL   GINS3   YEATS4   XRCC1   APLF   JAZF1   ZNHIT1   HMG20A   TRIM41  

Gene RIF (8)

AA Sequence 

MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTD      1 - 70
IFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                  71 - 127
//

Text Mined References (28)

PMID Year Title