Property Summary

NCBI Gene PubMed Count 22
PubMed Score 90.79
PubTator Score 42.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Essential Hypertension 94 0.0 3.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.796 1.2e-04

Gene RIF (4)

AA Sequence

MSETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMSLVALKKAL      1 - 70
AAAGYDVEKNNSRIKLSLKSLVNKGILVQTRGTGASGSFKLSKKVIPKSTRSKAKKSVSAKTKKLVLSRD     71 - 140
SKSPKTAKTNKRAKKPRATTPKTVRSGRKAKGAKGKQQQKSPVKARASKSKLTQHHEVNVRKATSKK       141 - 207
//

Text Mined References (22)

PMID Year Title