Property Summary

NCBI Gene PubMed Count 22
PubMed Score 91.28
PubTator Score 42.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.796 1.2e-04

Gene RIF (4)

PMID Text
26757249 These results suggested that the testis-specific linker histone, H1T, possesses a specific function to produce the chromatin architecture required for proper chromosome regulation, such as homologous recombination.
26362536 HIV-1 Gag interacts with HIST1H1T as demonstrated by proximity dependent biotinylation proteomics
24690621 HIV-1 Gag interacts with HIST1H1T as demonstrated by proximity dependent biotinylation proteomics
20587610 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMSLVALKKAL      1 - 70
AAAGYDVEKNNSRIKLSLKSLVNKGILVQTRGTGASGSFKLSKKVIPKSTRSKAKKSVSAKTKKLVLSRD     71 - 140
SKSPKTAKTNKRAKKPRATTPKTVRSGRKAKGAKGKQQQKSPVKARASKSKLTQHHEVNVRKATSKK       141 - 207
//

Text Mined References (22)

PMID Year Title
27018843 2016 Linker histone variant H1T targets rDNA repeats.
26757249 2016 Relaxed Chromatin Formation and Weak Suppression of Homologous Pairing by the Testis-Specific Linker Histone H1T.
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
22650316 2012 A unified phylogeny-based nomenclature for histone variants.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19820698 2009 Genome-wide association study identifies variants in TMPRSS6 associated with hemoglobin levels.
19806355 2010 An extensive analysis of the hereditary hemochromatosis gene HFE and neighboring histone genes: associations with childhood leukemia.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408966 2002 The human and mouse replication-dependent histone genes.
10529182 1999 Sequence preference of mouse H1(0) and H1t.
9809674 1998 Expression of mRNA and protein of nucleoproteins during human spermiogenesis.
9765591 1998 Poly(ADP-ribose) binding properties of histone H1 variants.
9149941 1997 A 1.1-Mb transcript map of the hereditary hemochromatosis locus.
9119399 1997 Human histone gene organization: nonregular arrangement within a large cluster.
8325638 1993 All known human H1 histone genes except the H1(0) gene are clustered on chromosome 6.
8175896 1994 Primate testicular histone H1t genes are highly conserved and the human H1t gene is located on chromosome 6.
1889752 1991 Structure and expression of the human gene encoding testicular H1 histone (H1t).