Property Summary

NCBI Gene PubMed Count 36
PubMed Score 38.99
PubTator Score 34.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer -1.600 1.9e-02
hepatocellular carcinoma -1.500 5.9e-04
lung cancer 1.700 4.2e-05
diabetes mellitus -1.200 2.9e-03
Multiple Sclerosis -1.600 9.2e-05
lung adenocarcinoma 1.800 2.8e-08
Breast cancer 1.400 8.6e-08

Gene RIF (11)

PMID Text
25048004 This study identified and confirmed HIST1H1E protein changes within the postsynaptic density in schizophrenia.
24873882 Histone H1.2-T165 post translational modifications are dispensable for chromatin binding and cell proliferation while the H1.4-K26 modifications are essential for proper cell cycle progression.
24435047 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
22465951 H1.4K34 acetylation is mediated by GCN5 and is preferentially enriched at promoters of active genes, where it stimulates transcription by increasing H1 mobility and recruiting a general transcription factor.
22425985 the N-terminal domain of H1 is an important determinant of affinity and specificity of H1-chromatin interactions.
21852232 PKA-mediated H1.4S35 phosphorylation dissociates H1.4 from mitotic chromatin but also suggest that this phosphorylation is necessary for specific mitotic functions.
21425800 Overexpression of NPM1 enhances HIV-1 Tat-mediated transactivation by reducing the histone H1 occupancy on the chromatinized template of HIV-1 LTR
20800603 Observational study of gene-disease association. (HuGE Navigator)
19144645 Dynamic Histone H1 Isotype 4 Methylation and Demethylation by Histone Lysine Methyltransferase G9a/KMT1C and the Jumonji Domain-containing JMJD2/KDM4 Proteins
15595731 the lysine residue adjacent to the phosphorylation site found on the serine residue on the H1.4 peptide KARKSAGAAKR was also shown to be methylated, raising the question of whether the hypothesized "methyl/phos" switch could be extended to linker histones
12498347 Allele-specific underacetylation of histone H4 downstream from promoter is associated with X-inactivation in human cells.

AA Sequence

MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAG      1 - 70
YDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGAAKKPKK     71 - 140
ATGAATPKKSAKKTPKKAKKPAAAAGAKKAKSPKKAKAAKPKKAPKSPAKAKAVKPKAAKPKTAKPKAAK    141 - 210
PKKAAAKKK                                                                 211 - 219
//

Text Mined References (48)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25048004 2015 Proteomic and genomic evidence implicates the postsynaptic density in schizophrenia.
24873882 2014 Dynamics and dispensability of variant-specific histone H1 Lys-26/Ser-27 and Thr-165 post-translational modifications.
24435047 2014 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22650316 2012 A unified phylogeny-based nomenclature for histone variants.
22465951 2012 A dual role of linker histone H1.4 Lys 34 acetylation in transcriptional activation.
22425985 2012 The N-terminal domain determines the affinity and specificity of H1 binding to chromatin.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21852232 2011 Protein kinase A-mediated serine 35 phosphorylation dissociates histone H1.4 from mitotic chromosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19144645 2009 Dynamic Histone H1 Isotype 4 Methylation and Demethylation by Histone Lysine Methyltransferase G9a/KMT1C and the Jumonji Domain-containing JMJD2/KDM4 Proteins.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18314153 2008 Histone H1e interacts with small hepatitis delta antigen and affects hepatitis delta virus replication.
17540172 2007 L3MBTL1, a histone-methylation-dependent chromatin lock.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16127177 2005 HP1 binds specifically to Lys26-methylated histone H1.4, whereas simultaneous Ser27 phosphorylation blocks HP1 binding.
15911621 2005 H1 family histones in the nucleus. Control of binding and localization by the C-terminal domain.
15635413 2005 Nucleolar proteome dynamics.
15595731 Characterization of phosphorylation sites on histone H1 isoforms by tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469825 2004 Human SirT1 interacts with histone H1 and promotes formation of facultative heterochromatin.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12498347 2002 Allele-specific underacetylation of histone H4 downstream from promoters is associated with X-inactivation in human cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408966 2002 The human and mouse replication-dependent histone genes.
11746507 2001 Distribution of somatic H1 subtypes is non-random on active vs. inactive chromatin II: distribution in human adult fibroblasts.
11467742 2001 A compendium of the histone H1 family of somatic subtypes: an elusive cast of characters and their characteristics.
10997781 2000 The distribution of somatic H1 subtypes is non-random on active vs. inactive chromatin: distribution in human fetal fibroblasts.
9439656 1997 The human histone gene cluster at the D6S105 locus.
9119399 1997 Human histone gene organization: nonregular arrangement within a large cluster.
8325638 1993 All known human H1 histone genes except the H1(0) gene are clustered on chromosome 6.
8003976 1994 A proposal for a coherent mammalian histone H1 nomenclature correlated with amino acid sequences.
7607502 1995 Specific variants of H1 histone regulate CpG methylation in eukaryotic DNA.
3782055 1986 Human spleen histone H1. Isolation and amino acid sequence of a main variant, H1b.
1916825 1991 Isolation and characterization of two human H1 histone genes within clusters of core histone genes.