Property Summary

NCBI Gene PubMed Count 35
PubMed Score 89.96
PubTator Score 72.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
gastric cancer -1.600 1.2e-03
hepatocellular carcinoma -1.500 3.3e-05
Multiple myeloma 3.148 1.6e-03
cystic fibrosis 2.098 3.4e-06
atypical teratoid / rhabdoid tumor 1.500 9.8e-03
glioblastoma 1.400 6.4e-03
Duchenne muscular dystrophy -1.307 2.7e-08
pancreatic ductal adenocarcinoma liver m... -1.800 8.3e-03
non-small cell lung cancer 1.148 3.7e-08
X-linked cerebral adrenoleukodystrophy -1.500 2.6e-02
lung cancer 1.900 5.1e-04
diabetes mellitus -1.200 8.4e-03
interstitial cystitis 2.300 8.0e-05
pediatric high grade glioma 1.300 1.1e-03
posterior fossa group A ependymoma 1.300 6.7e-05
non primary Sjogren syndrome sicca 1.200 2.0e-02
lung adenocarcinoma 1.800 1.2e-05
psoriasis -1.300 9.1e-04
breast carcinoma 1.400 3.3e-17
Breast cancer 1.600 1.9e-05
invasive ductal carcinoma 2.800 1.1e-02
ovarian cancer 2.100 5.6e-04
pituitary cancer 2.700 6.6e-05
dermatomyositis 1.100 2.2e-03

Gene RIF (15)

PMID Text
25631074 Cellular biotinylated histone cluster 1, H1c (HIST1H1C) protein is incorporated into HIV-1 Gag virus-like particles
24873882 Histone H1.2-T165 post translational modifications are dispensable for chromatin binding and cell proliferation while the H1.4-K26 modifications are essential for proper cell cycle progression.
24525734 Integration with apoptotic intermediates (via C-terminal tail interactions) may constitute a more generalized function of linker histone isoforms in apoptotic cascades.
24476918 H1.2 is less abundant than other histone H1 variants at the transcription start sites of inactive genes, and promoters enriched in H1.2 are different from those enriched in other histone H1 variants and tend to be repressed.
24435047 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
24360965 H1.2 interacts with Cul4A and PAF1 to activate developmental regulatory genes.
22249259 These data suggest that p53 acetylation-H1.2 phosphorylation cascade serves as a unique mechanism for triggering p53-dependent DNA damage response pathways.
21425800 Cellular biotinylated histone cluster 1, H1c (HIST1H1C) protein is incorporated into HIV-1 Gag virus-like particles
20800603 Observational study of gene-disease association. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
18568448 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18258596 that the recruitment of YB1, PURalpha, and H1.2 to the p53 target gene Bax is required for repression of p53-induced transcription.
17879944 Histone H1.2 was translocated from the nucleus to the mitochondria after treatment with bleomycin and co-localized with Bak in mitochondria.
16854430 The binding of histone H1 to a general amyloid-like motif indicates that histone H1 may play an important common role in diseases associated with amyloid-like fibrils.
15595731 confirmed N-terminal acetylation on all isoforms plus a single internal acetylation site; phosphorylation sites were located on peptides containing the cyclin dependent kinase (CDK) consensus motif

AA Sequence

MSETAPAAPAAAPPAEKAPVKKKAAKKAGGTPRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAG      1 - 70
YDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKVKKAGGTKPKKPVGAAKKPKK     71 - 140
AAGGATPKKSAKKTPKKAKKPAAATVTKKVAKSPKKAKVAKPKKAAKSAAKAVKPKAAKPKVVKPKKAAP    141 - 210
KKK                                                                       211 - 213
//

Text Mined References (49)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24873882 2014 Dynamics and dispensability of variant-specific histone H1 Lys-26/Ser-27 and Thr-165 post-translational modifications.
24525734 2014 The C-terminal domain (CTD) in linker histones antagonizes anti-apoptotic proteins to modulate apoptotic outcomes at the mitochondrion.
24476918 2014 Mapping of six somatic linker histone H1 variants in human breast cancer cells uncovers specific features of H1.2.
24435047 2014 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
24360965 2013 Linker Histone H1.2 cooperates with Cul4A and PAF1 to drive H4K31 ubiquitylation-mediated transactivation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22650316 2012 A unified phylogeny-based nomenclature for histone variants.
22249259 2012 Functional interplay between p53 acetylation and H1.2 phosphorylation in p53-regulated transcription.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20334638 2010 Histone H1 variant-specific lysine methylation by G9a/KMT1C and Glp1/KMT1D.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18568448 2008 Calbindin 1, fibroblast growth factor 20, and alpha-synuclein in sporadic Parkinson's disease.
18258596 2008 Isolation and characterization of a novel H1.2 complex that acts as a repressor of p53-mediated transcription.
17879944 2008 Histone H1.2 is translocated to mitochondria and associates with Bak in bleomycin-induced apoptotic cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16854430 2006 Linker histone H1 binds to disease associated amyloid-like fibrils.
15911621 2005 H1 family histones in the nucleus. Control of binding and localization by the C-terminal domain.
15635413 2005 Nucleolar proteome dynamics.
15595731 Characterization of phosphorylation sites on histone H1 isoforms by tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408966 2002 The human and mouse replication-dependent histone genes.
11746507 2001 Distribution of somatic H1 subtypes is non-random on active vs. inactive chromatin II: distribution in human adult fibroblasts.
11467742 2001 A compendium of the histone H1 family of somatic subtypes: an elusive cast of characters and their characteristics.
10997781 2000 The distribution of somatic H1 subtypes is non-random on active vs. inactive chromatin: distribution in human fetal fibroblasts.
10893414 2000 Characterization of the histone H1-binding protein, NASP, as a cell cycle-regulated somatic protein.
9439656 1997 The human histone gene cluster at the D6S105 locus.
8325638 1993 All known human H1 histone genes except the H1(0) gene are clustered on chromosome 6.
8055927 1994 Role of a distal promoter element in the S-phase control of the human H1.2 histone gene transcription.
8003976 1994 A proposal for a coherent mammalian histone H1 nomenclature correlated with amino acid sequences.
7821789 1994 Construction of a human full-length cDNA bank.
2759094 1989 Human H1 histones: conserved and varied sequence elements in two H1 subtype genes.
2613692 1989 Human spleen histone H1. Isolation and amino acid sequences of three minor variants, H1a, H1c, and H1d.