Property Summary

NCBI Gene PubMed Count 31
PubMed Score 39.47
PubTator Score 85.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 2.000 5.6e-08
psoriasis 1.600 4.3e-05
atypical teratoid / rhabdoid tumor -2.000 1.3e-04
glioblastoma -1.200 2.5e-03
medulloblastoma, large-cell -1.500 7.3e-05
juvenile dermatomyositis 1.333 3.6e-09
acute quadriplegic myopathy 1.117 8.9e-06
adult high grade glioma -1.300 1.1e-02
aldosterone-producing adenoma -1.121 4.3e-02
lung adenocarcinoma 1.103 3.3e-03
ovarian cancer -1.900 1.9e-07

Protein-protein Interaction (4)

Gene RIF (13)

PMID Text
25512559 HIRA controls a specialized, dynamic H4K16ac-decorated chromatin landscape in senescent cells and enforces tumor suppression.
24074863 Mechanistic studies reveal that HIRA accumulates at sites of UVC irradiation upon detection of DNA damage prior to repair and deposits newly synthesized H3.3 histones. This local action of HIRA depends on ubiquitylation events associated with damage recognition.
23602572 HIRA is required for deposition of histone H3.3 at its binding sites.
22401310 NHRD domain of UBN1 as being an essential region for HIRA interaction and chromatin organization by the HUCA complex
21807893 Data show that, like HIRA, UBN1, and ASF1a, CABIN1 is involved in heterochromatinization of the genome of senescent human cells.
21724829 phosphorylation of histone H4 Ser 47 catalyzed by the PAK2 kinase, promotes nucleosome assembly of H3.3-H4 and inhibits nucleosome assembly of H3.1-H4 by increasing the binding affinity of HIRA to H3.3-H4 and reducing association of CAF-1 with H3.1-H4
21347226 HIRA plays a unique, ASF1a-independent role, which is required for the localization of HP1
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19046189 FISH analysis of metaphases revealed a duplication of TUPLE1 probe on one chromosome 22q (Fig. 1).
19029251 Hpc2-related domain of UBN1, UBN2, and Hpc2p is an evolutionarily conserved HIRA/Hir-binding domain, which directly interacts with the N-terminal WD repeats of HIRA/Hir.
16980972 The N- and C-terminal regions of ASF1a and ASF1b determine the different affinities of these two proteins for HIRA, by contacting regions outside the HIRA B domain. CAF-1 also uses B domain-like motifs for binding to ASF1a, thereby competing with HIRA.
16024922 the N-terminal half of HIRA should contribute positively to the growth rate via up-regulation of a set of cell cycle-related genes, whereas the C-terminal half down-regulated another set of them without exhibiting any effect on the cell growth

AA Sequence

MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIPKMLCQMDNHL      1 - 70
ACVNCVRWSNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRNHSGDVMDVAWS     71 - 140
PHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGLTWDPVGKYIASQADDRSLKVWRTLDWQLET    141 - 210
SITKPFDECGGTTHVLRLSWSPDGHYLVSAHAMNNSGPTAQIIEREGWKTNMDFVGHRKAVTVVKFNPKI    211 - 280
FKKKQKNGSSAKPSCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDG    281 - 350
SVAFLDFSQDELGDPLSEEEKSRIHQSTYGKSLAIMTEAQLSTAVIENPEMLKYQRRQQQQQLDQKSAAT    351 - 420
REMGSATSVAGVVNGESLEDIRKNLLKKQVETRTADGRRRITPLCIAQLDTGDFSTAFFNSIPLSGSLAG    421 - 490
TMLSSHSSPQLLPLDSSTPNSFGASKPCTEPVVAASARPAGDSVNKDSMNATSTPAALSPSVLTTPSKIE    491 - 560
PMKAFDSRFTERSKATPGAPALTSMTPTAVERLKEQNLVKELRPRDLLESSSDSDEKVPLAKASSLSKRK    561 - 630
LELEVETVEKKKKGRPRKDSRLMPVSLSVQSPAALTAEKEAMCLSAPALALKLPIPSPQRAFTLQVSSDP    631 - 700
SMYIEVENEVTVVGGVKLSRLKCNREGKEWETVLTSRILTAAGSCDVVCVACEKRMLSVFSTCGRRLLSP    701 - 770
ILLPSPISTLHCTGSYVMALTAAATLSVWDVHRQVVVVKEESLHSILAGSDMTVSQILLTQHGIPVMNLS    771 - 840
DGKAYCFNPSLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVV    841 - 910
QQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVG    911 - 980
LRKRELLKELLPVIGQNLRFQRLFTECQEQLDILRDK                                     981 - 1017
//

Text Mined References (40)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25512559 2014 HIRA orchestrates a dynamic chromatin landscape in senescence and is required for suppression of neoplasia.
24074863 2013 Transcription recovery after DNA damage requires chromatin priming by the H3.3 histone chaperone HIRA.
23602572 2013 Placing the HIRA histone chaperone complex in the chromatin landscape.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22401310 2012 Identification of an ubinuclein 1 region required for stability and function of the human HIRA/UBN1/CABIN1/ASF1a histone H3.3 chaperone complex.
21807893 2011 Human CABIN1 is a functional member of the human HIRA/UBN1/ASF1a histone H3.3 chaperone complex.
21724829 2011 Phosphorylation of H4 Ser 47 promotes HIRA-mediated nucleosome assembly.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21347226 2011 HP1-mediated formation of alternative lengthening of telomeres-associated PML bodies requires HIRA but not ASF1a.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19046189 2008 Microduplication 22q11.2 in a child with autism spectrum disorder: clinical and genetic study.
19029251 2009 Human UBN1 is an ortholog of yeast Hpc2p and has an essential role in the HIRA/ASF1a chromatin-remodeling pathway in senescent cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
17242207 2007 Molecular dissection of formation of senescence-associated heterochromatin foci.
16980972 2006 Structure of a human ASF1a-HIRA complex and insights into specificity of histone chaperone complex assembly.
16024922 2005 Different roles of N-terminal and C-terminal halves of HIRA in transcription regulation of cell cycle-related genes that contribute to control of vertebrate cell growth.
15621527 2005 Formation of MacroH2A-containing senescence-associated heterochromatin foci and senescence driven by ASF1a and HIRA.
15561718 2005 Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15231747 2004 A protein interaction framework for human mRNA degradation.
14718166 2004 Histone H3.1 and H3.3 complexes mediate nucleosome assembly pathways dependent or independent of DNA synthesis.
14680630 2003 Structure and function of the conserved core of histone deposition protein Asf1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370293 2002 Coupling of DNA synthesis and histone synthesis in S phase independent of cyclin/cdk2 activity.
11342215 2001 Identification of human and mouse HIRA-interacting protein-5 (HIRIP5), two mammalian representatives in a family of phylogenetically conserved proteins with a role in the biogenesis of Fe/S proteins.
11238922 2001 HIRA, the human homologue of yeast Hir1p and Hir2p, is a novel cyclin-cdk2 substrate whose expression blocks S-phase progression.
9731536 1998 HIRA, a mammalian homologue of Saccharomyces cerevisiae transcriptional co-repressors, interacts with Pax3.
9710638 1998 Core histones and HIRIP3, a novel histone-binding protein, directly interact with WD repeat protein HIRA.
9063745 1997 The murine homologue of HIRA, a DiGeorge syndrome candidate gene, is expressed in embryonic structures affected in human CATCH22 patients.
8995764 1996 Genomic organization of TUPLE1/HIRA: a gene implicated in DiGeorge syndrome.
8681138 1996 Structural Organization of the WD repeat protein-encoding gene HIRA in the DiGeorge syndrome critical region of human chromosome 22.
8111380 1993 Isolation of a putative transcriptional regulator from the region of 22q11 deleted in DiGeorge syndrome, Shprintzen syndrome and familial congenital heart disease.
7633437 1995 A human homolog of the S. cerevisiae HIR1 and HIR2 transcriptional repressors cloned from the DiGeorge syndrome critical region.