Property Summary

Ligand Count 2
NCBI Gene PubMed Count 22
PubMed Score 58.16
PubTator Score 22.00

Knowledge Summary

Patent (4,064)

Expression

  Differential Expression (21)

Disease log2 FC p
aldosterone-producing adenoma -1.705 1.6e-02
Atopic dermatitis 1.300 2.0e-02
atypical teratoid / rhabdoid tumor 1.100 8.3e-04
colon cancer -1.100 1.1e-03
COPD -1.200 1.3e-02
dermatomyositis -1.600 2.8e-04
ependymoma 2.100 1.1e-02
glioblastoma 1.200 7.3e-03
group 4 medulloblastoma 1.500 2.1e-02
hereditary spastic paraplegia -1.080 1.1e-02
invasive ductal carcinoma -1.204 1.2e-02
limb girdle muscular dystrophy 2A -1.082 4.7e-03
lung cancer -1.300 2.5e-03
malignant mesothelioma -1.400 6.4e-05
medulloblastoma, large-cell 1.400 2.7e-03
oligodendroglioma 1.100 4.7e-02
osteosarcoma 1.078 1.8e-02
ovarian cancer -2.100 1.4e-07
pancreatic cancer 1.200 4.8e-03
pediatric high grade glioma 1.100 4.7e-02
primary pancreatic ductal adenocarcinoma 1.180 4.4e-03

 GWAS Trait (1)

Gene RIF (6)

AA Sequence

MASQVLVYPPYVYQTQSSAFCSVKKLKVEPSSCVFQERNYPRTYVNGRNFGNSHPPTKGSAFQTKIPFNR      1 - 70
PRGHNFSLQTSAVVLKNTAGATKVIAAQAQQAHVQAPQIGAWRNRLHFLEGPQRCGLKRKSEELDNHSSA     71 - 140
MQIVDELSILPAMLQTNMGNPVTVVTATTGSKQNCTTGEGDYQLVQHEVLCSMKNTYEVLDFLGRGTFGQ    141 - 210
VVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTENADEYNFVRAYECFQHRNHTCLVFEMLEQ    211 - 280
NLYDFLKQNKFSPLPLKVIRPILQQVATALKKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASH    281 - 350
VSKTVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGALEYDQIRYISQTQGLPGE    351 - 420
QLLNVGTKSTRFFCKETDMSHSGWRLKTLEEHEAETGMKSKEARKYIFNSLDDVAHVNTVMDLEGSDLLA    421 - 490
EKADRREFVSLLKKMLLIDADLRITPAETLNHPFVNMKHLLDFPHSNHVKSCFHIMDICKSHLNSCDTNN    491 - 560
HNKTSLLRPVASSSTATLTANFTKIGTLRSQALTTSAHSVVHHGIPLQAGTAQFGCGDAFQQTLIICPPA    561 - 630
IQGIPATHGKPTSYSIRVDNTVPLVTQAPAVQPLQIRPGVLSQTWSGRTQQMLVPAWQQVTPLAPATTTL    631 - 700
TSESVAGSHRLGDWGKMISCSNHYNSVMPQPLLTNQITLSAPQPVSVGIAHVVWPQPATTKKNKQCQNRG    701 - 770
ILVKLMEWEPGREEINAFSWSNSLQNTNIPHSAFISPKIINGKDVEEVSCIETQDNQNSEGEARNCCETS    771 - 840
IRQDSDSSVSDKQRQTIIIADSPSPAVSVITISSDTDEEETSQRHSLRECKGSLDCEACQSTLNIDRMCS    841 - 910
LSSPDSTLSTSSSGQSSPSPCKRPNSMSDEEQESSCDTVDGSPTSDSSGHDSPFAESTFVEDTHENTELV    911 - 980
SSADTETKPAVCSVVVPPVELENGLNADEHMANTDSICQPLIKGRSAPGRLNQPSAVGTRQQKLTSAFQQ    981 - 1050
QHLNFSQVQHFGSGHQEWNGNFGHRRQQAYIPTSVTSNPFTLSHGSPNHTAVHAHLAGNTHLGGQPTLLP   1051 - 1120
YPSSATLSSAAPVAHLLASPCTSRPMLQHPTYNISHPSGIVHQVPVGLNPRLLPSPTIHQTQYKPIFPPH   1121 - 1190
SYIAASPAYTGFPLSPTKLSQYPYM                                                1191 - 1215
//

Text Mined References (24)

PMID Year Title