Property Summary

NCBI Gene PubMed Count 132
PubMed Score 125.07
PubTator Score 125.03

Knowledge Summary

Patent (5,210)

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 2.700 1.4e-03
gastric cancer 1.100 5.8e-04
malignant mesothelioma -1.900 1.9e-06
astrocytic glioma 1.700 1.3e-02
oligodendroglioma 1.600 1.0e-02
psoriasis 1.400 9.8e-04
osteosarcoma 2.503 6.1e-07
sonic hedgehog group medulloblastoma -1.700 5.3e-04
atypical teratoid/rhabdoid tumor -1.300 5.0e-05
glioblastoma 1.400 1.2e-03
medulloblastoma, large-cell -2.200 4.9e-04
hereditary spastic paraplegia -1.047 2.7e-02
tuberculosis and treatment for 6 months -1.200 8.4e-03
intraductal papillary-mucinous adenoma (... 1.200 7.5e-03
adult high grade glioma -1.400 7.3e-04
subependymal giant cell astrocytoma -1.808 1.4e-02
Pick disease 1.400 1.6e-04
invasive ductal carcinoma -1.200 1.7e-03
ovarian cancer -1.700 2.3e-04
pituitary cancer -1.500 1.9e-02
Down syndrome 1.400 6.0e-03

Protein-protein Interaction (5)

Gene RIF (104)

PMID Text
26633710 Results indicate that Hipk2 exerts a relevant role in the survival of cerebellar Purkinje cells and that Hipk2 genetic ablation generates cerebellar dysfunction compatible with an ataxic-like phenotype.
26247811 The findings highlight a complex regulation of CREB-binding protein activity by HIPK2, which might be relevant for the control of specific sets of target genes involved in cellular proliferation, differentiation and apoptosis.
26113041 Our findings indicate that phosphorylation-dependent restriction of SIRT1 activity by HIPK2 shapes the p53 response
26102034 Lafora disease proteins laforin and malin negatively regulate the HIPK2-p53 cell death pathway.
25961923 MDM4/HIPK2/p53 cytoplasmic assembly uncovers coordinated repression of molecules with anti-apoptotic activity during early DNA damage response.
25944899 c-Abl was required for endogenous HIPK2 accumulation and phosphorylation of p53 at Ser46 in response to DNA damage by gamma- and UV radiation.
25868975 Results indicate that HIPK2 acts as a caretaker gene, whose inactivation increases tumorigenicity and causes chromosomal instability by cytokinesis failure.
25820028 This work describes a novel mechanism of translational suppression by Pdcd4 and shows for the first time that Hipk2 controls its own synthesis by an auto-regulatory feedback mechanism.
25778922 Ras induces the formation of a complex between NORE1A and the kinase HIPK2, enhancing HIPK2 association with p53.
25711204 HIPK2 expression tends to be decreased along tumor progression and may be involved with the invasive potential, suggesting a possible tumor suppressor role for HIPK2.
25630557 Analysis of these mutants revealed that HIPK1, HIPK2 and HIPK3 but not HIPK4 are capable of autophosphorylating on other tyrosines
25552543 Homeodomain-interacting protein kinase 2, a novel autoimmune regulator interaction partner, modulates promiscuous gene expression in medullary thymic epithelial cells
25421593 the role and mechanism of miR141 in regulating renal fibrosis via the TGFbeta1/miR-141/HIPK2/EMT axis
25313037 XAF1 stimulates HIPK2-mediated Ser-46 phosphorylation of p53 and XAF1 also steps up the termination of p53-mediated cell-cycle arrest by activating ZNF313.
25210797 HIPK2 depletion strongly decreases Che-1 ubiquitylation and degradation.
25151962 HIPK2/HP1gamma pathway may uncover a new functional aspect of HIPK2 as a tumor suppressor.
24846322 Results show that downregulation of HIPK2 increases resistance of bladder cancer cell to cisplatin by regulating Wip1.
24829283 In response to severe DNA damage, p53 phosphorylation at Ser46 is promoted by the accumulation of HIPK2 due to downregulation of nuclear Mdm2 in the later phase of the response.
24824041 Hipk2 knockdown resulted in decreased E-cadherin expression and increased N-cadherin and fibronectin expression, and induced Wnt signaling activation and beta-catenin nuclear localization, indicating that epithelial-mesenchymal transition was induced.
24270405 These results provide evidence that HIPK2 and Pin1 work together to promote cortical neurogenesis, at least in part, by suppressing Gro/TLE1:Hes1-mediated inhibition of neuronal differentiation.
24211575 These results suggest that SIRT1 may deacetylate and promote the ubiquitination and subsequent proteasomal degradation of HIPK2.
24196445 our results suggest that Src kinase suppresses the apoptotic p53 pathway by phosphorylating HIPK2 and relocalizing the kinase to the cytoplasm.
24145406 HIPK2 autointeracts and site-specifically autophosphorylates upon DNA damage at Thr880/Ser882.
24107646 activation of the IL-4/STAT6 signaling pathway has a crucial role in aberrant glycosylation of IgA1 secretion, which is mediated by HIPK2
23871434 In response to ionizing radiation, HIPK2 phosphorylation promotes inhibition of WIP1 phosphorylation through dissociation of WIP1 from HIPK2, followed by stabilization of WIP1 for termination of the ATM-mediated double-strand break signaling cascade.
23722549 PKA-mediated phosphorylation of PML-RARalpha blocked its ability to inhibit PML oligomerization and destabilize HIPK2.
23703384 HIPK2 silencing may contribute to induce resistance to cell death in glucose restriction condition.
23565059 HIPK1 and HIPK2, are transcriptional corepressors that regulate TGF-beta-dependent angiogenesis during embryonic development.
23540226 On the basis of transmission disequilibrium test results, the influence of 2 single nucleotide polymorphisms of HIPK2 gene on prevalence of chronic kidney disease was not identified.
23144866 HIPK2 knockdown in colon cancer cells resulted in cyclooxygenase-2 upregulation and COX-2-derived PGE(2) generation.
22689412 HIPK2 dysfunction may play a role in fibroblasts behavior and in idiopathic pulmonary fibrosis pathogenesis.
22658722 Data indicate a critical kinase HIPK2 function in cytokinesis and in the prevention of tetraploidization.
22503103 identify ROS-induced acetylation of the proapoptotic kinase HIPK2 as a molecular mechanism that controls the threshold discerning sensitivity from resistance toward ROS-mediated cell death
22406746 This study identified homeo-domain interacting protein kinase 2 (HIPK2) as a key regulator of kidney fibrosis.
22395153 HIPK2 expression is higher in cervical cancer tissues and has a positive correlation with cervical cancer. HIPK2 may be important in the development of cervical cancer.
22236966 Data show that vimentin is a novel target for HIPK2 repressor function and that HIPK2-mediated vimentin downregulation can contribute to inhibition of breast cancer cells invasion.
22110707 cutaneous HPV23 E6 prevents HIPK2-mediated p53 Ser 46 phosphorylation
21715331 HIPK2-mediated regulation of p27(kip1) revealed a contribution to cell motility, rather than to cell proliferation, but only in cells that do not express wild-type p53.
21602882 show that HIPK2 depletion interferes with DeltaNp63alpha degradation, and expression of a HIPK2-resistant DeltaNp63alpha-Delta390 mutant induces chemoresistance
21569099 Thus, these results suggest that the mutations of the HIPK2 gene maybe a rare event in the development of KA and SCC of the skin in Korean population.
21514416 our results point to a prominent and p53-independent role of HIPK2 in colon cancer survival.
21285352 HIPK2 up-regulates transcription by phosphorylating TCF3, a transcriptional repressor, but inhibits transcription by phosphorylating LEF1, a transcriptional activator.
21248371 These findings identify a novel circuitry between HIF-1alpha and p53, and provide a paradigm for HIPK2 dictating cell response to antitumor therapies.
21248071 Findings suggest an unforeseen role for Zyxin in DNA damage-induced cell fate control through modulating the HIPK2-p53 signaling axis.
21192925 These results suggest that SUMO interaction motif-mediated HIPK2 targeting to PML-NBs is crucial for HIPK2-mediated p53 activation and induction of apoptosis.
21173028 Data show that p53(S46) kinase HIPK2 accumulates on MYCN expression, and its depletion by RNA interference impairs p53(S46) phosphorylation and apoptosis.
20980392 Results suggest that HIPK2 is a new ATF1 kinase involved in the regulation of ferritin H and other antioxidant detoxification genes in genotoxic stress conditions.
20940704 Han11 was required to allow coupling of MEKK1 to DYRK1 and HIPK2.
20849851 In tumors with wild-type p53, its tumor suppressor function is often impaired by MDM2 overexpression that targets p53 for proteasomal degradation. Likewise, MDM2 targets HIPK2 for protein degradation impairing p53-apoptotic function.
20624637 The deregulation of miR-27a may be involved in the development of drug resistance, regulating the expression of MDR1/P-gp, at least in part, by targeting HIPK2 in ovarian cancer cells.
20573984 Results demonstrate that HIPK2 is a new CREB kinase that regulates CREB-dependent transcription in genotoxic stress.
20418953 beta-amyloid 1-40 induces HIPK2 degradation and alters HIPK2 binding activity to DNA, in turn regulating the p53 conformational state and vulnerability to a noxious stimulus.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19950553 HIPK2 protein expression is positively correlated with HPV infection, but negatively with apoptotic index in cervical cancers.
19828042 These results reveal a novel role for HIPK2 in activating p53 apoptotic transcription.
19820693 MeCP2 cooperates with HIPK2 in induction of apoptosis and Ser 80 phosphorylation is required together with the DNA binding of MeCP2.
19794125 As predicted from the genomic organization at this locus, 22 of 36 patients with pilocytic astrocytomas and B-Raf gene rearrangement also exhibit corresponding HIPK2 gene amplification.
19714248 show here for the first time that hypoxia-induced HIPK2 deregulation was counteracted by zinc that restored HIPK2 suppression of HIF-1 pathway and reactivated p53 apoptotic response to drug
19668373 the homeodomain-interacting protein kinase-2 (HIPK2) and p53 were found activated along a pro-apoptotic signalling pathway while p21(waf1,cip1,sdi1) was prevented from its protective action
19567674 Consistent with in vitro findings, a strong correlation between beta(4) overexpression and HIPK2 inactivation by cytoplasmic relocalization was observed in wtp53-expressing breast carcinomas.
19448668 Results show that overexpressing HIPK2 causes the degradation of ZBTB4, whereas overexpressing a kinase-deficient mutant of HIPK2 has no effect.
19438900 HIPK2 was found to be involved in cell-cycle regulation dependent on p21(Waf-1/Cip-1) and independent of DNA damage
19128456 Overexpression of HIPK2 resulted in subsequent inhibition of HIF-1 transcriptional activity
19046997 HIPK2-mediated transcriptional regulation of HIF-1alpha that might play a critical role in VEGF expression.
19043406 As HIPK2 has an important role as a negative regulator of gene expression, its elimination from promoter-associated repressor complexes allows the induction of a substantial fraction of hypoxia-induced genes.
19015637 DNA damage-induced PML SUMOylation and are required for the ability of PML to cooperate with HIPK2 for the induction of cell death.
18996371 Inhibition of MT2A expression by siRNA in the HIPK2 knockdown cells restored p53 transcription activity.
18809579 Fbx3 formed SCF(Fbx3) ubiquitin ligase and promoted the degradation of HIPK2 and p300 by the ubiquitin-proteasome pathway.PML inhibited this degradation.
18695000 the oncogenic protein PEBP2-beta-SMMHC prevents RUNX1/p300 phosphorylation by sequestering HIPK2 to mislocalized RUNX1/beta-SMMHC complexes
18644116 HIPK2 overexpression in tumor cells downregulated vascular endothelial growth factor mRNA levels and VEGF promoter activity.
18536714 Results describe the control of HIPK2 stability by ubiquitin ligase Siah-1 and checkpoint kinases ATM and ATR.
18483253 HIPK2 has a critical role in maintaining the transactivation activity of wtp53; low expression of HIPK2 may impair the p53 function in tumors harboring wtp53
18408760 Frequent HIPK2 amplification and increased expression in pilocytic astrocytomas.
18395248 HIPK2 is an important regulator of p53 activity in response to a chemotherapeutic drug. These results suggest that different drug-activated pathways may regulate HIPK2 and that HIPK2/p53Ser46 deregulation is involved in chemoresistance.
18093972 the regulatory mechanisms by which HIPK2 is maintained at a low level, by WSB-1 in cells under normal conditions, and stabilized by genotoxic stresses.
17960875 HIPK2 and Cdc2 phosphorylate chromosomal high-mobility group A protein HMGA1 at the same site but show different site preferences.
17627287 HIPK2-induced p53Ser46 phosphorylation activates the KILLER/DR5-mediated caspase-8 extrinsic apoptotic pathway.
17533375 dysfunction of HIPK2 may play a role in the pathogenesis of leukemia
17349959 These findings establish HIPK2 as an MDM2 target and support a model in which, upon nonsevere DNA damage, p53 represses its own phosphorylation at Ser46 due to HIPK2 degradation.
17332358 HIPK2 is the IR-activated p53 Ser(46) kinase and is regulated by ATM.
17245128 Review summarizes recent findings from experimental HIPK2-guided gene expression programs that trigger differentiation and development or, alternatively, apoptosis.
17018294 Pc2 binds to and colocalizes with homeodomain interacting protein kinase 2 (HIPK2) and serves as a SUMO E3 ligase for this kinase.
16738336 HIPK2 cooperates with p53 in Gal-3 repression and that this cooperation requires HIPK2 kinase activity.
16601678 Degradation of endogenous HIPK2 depends on the presence of a functional p53 protein.
16467083 The homeodomain interacting protein kinase 2(HIPK2) overexpression, along with histone deacetylase-1, inhibited the cPLA2-luc promoter that is strongly acetylated in HIPK2i cells.
16407227 HIPK2 is an upstream protein kinase for Pax6 that may modulate Pax6-mediated transcriptional regulation
16343438 Overall, our findings indicate that FHL2 can also regulate p53 via a direct association with HIPK2.
16253240 HIPK2 is a target for SENP1 desumoylation regulated by the cytoplasmic-nuclear shuttling of SENP1.
16212962 HIPK2 contributes to drug-induced modulation of MDM2 activity at transcriptional (through p53Ser46 phosphorylation) and posttranscriptional (through p53-independent subcellular re-localization and proteasomal degradation) levels.
15958389 HIPK2 effector function on JNK is modulated through dynamic SUMO-1 modification
15896780 phosphorylation-dependent sumoylation enables HIPK2 to drive different target gene transcription by means of differential interactions with its binding partners
15766567 a non-sumoylatable HIPK2 mutant displays a strongly increased protein stability
15708980 Homeodomain-interacting protein kinase-2 (HIPK2) mediates CtBP phosphorylation and degradation in UV-triggered apoptosis.
15122315 HIPK2 neutralizes MDM2 inhibition rescuing p53 transcriptional activity and apoptotic function.
15122315 the mechanisms by which the HIPK2/p53 pathway promotes apoptosis and suppression of tumorigenesis.
14990717 US11 of herpes simplex virus interacts with HIPK2 through the PEST domain of HIPK2 and this interaction modifies the subcellular distribution of HIPK2 and protects the cell against the HIPK2-induced cell growth arrest
14678985 HIPK2 participates in the TGF-beta signaling pathway leading to JNK activation and apoptosis in hepatoma cells.
14647468 a novel function for Sp100 as a coactivator for HIPK2-mediated p53 activation.
12907596 HIPK2-mediated enhancement of p53-dependent transcription, p53 serine 46 phosphorylation and the antiproliferative function of HIPK2 strictly rely on the presence of PML.
12874272 HIPK2, together with c-Ski, plays an important role in the negative regulation of BMP-induced transcriptional activation
12851404 TP53INP1s and HIPK2 could be partners in regulating p53 activity.
12220523 overexpressed wildtype HIPK2 and a kinase defective mutant of HIPK2 directly interact with RanBPM in the nucleus of mammalian cells.
11925430 Identification and characterization; modulates functions of the p53 family in vivo.
11740489 selectively phosphorylates p53 at Ser 46, thus facilitating the CBP-mediated acetylation of p53 at Lys 382, and promoting p53-dependent gene expression

AA Sequence

MAPVYEGMASHVQVFSPHTLQSSAFCSVKKLKIEPSSNWDMTGYGSHSKVYSQSKNIPLSQPATTTVSTS      1 - 70
LPVPNPSLPYEQTIVFPGSTGHIVVTSASSTSVTGQVLGGPHNLMRRSTVSLLDTYQKCGLKRKSEEIEN     71 - 140
TSSVQIIEEHPPMIQNNASGATVATATTSTATSKNSGSNSEGDYQLVQHEVLCSMTNTYEVLEFLGRGTF    141 - 210
GQVVKCWKRGTNEIVAIKILKNHPSYARQGQIEVSILARLSTESADDYNFVRAYECFQHKNHTCLVFEML    211 - 280
EQNLYDFLKQNKFSPLPLKYIRPVLQQVATALMKLKSLGLIHADLKPENIMLVDPSRQPYRVKVIDFGSA    281 - 350
SHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLP    351 - 420
AEYLLSAGTKTTRFFNRDTDSPYPLWRLKTPDDHEAETGIKSKEARKYIFNCLDDMAQVNMTTDLEGSDM    421 - 490
LVEKADRREFIDLLKKMLTIDADKRITPIETLNHPFVTMTHLLDFPHSTHVKSCFQNMEICKRRVNMYDT    491 - 560
VNQSKTPFITHVAPSTSTNLTMTFNNQLTTVHNQAPSSTSATISLANPEVSILNYPSTLYQPSAASMAAV    561 - 630
AQRSMPLQTGTAQICARPDPFQQALIVCPPGFQGLQASPSKHAGYSVRMENAVPIVTQAPGAQPLQIQPG    631 - 700
LLAQQAWPSGTQQILLPPAWQQLTGVATHTSVQHATVIPETMAGTQQLADWRNTHAHGSHYNPIMQQPAL    701 - 770
LTGHVTLPAAQPLNVGVAHVMRQQPTSTTSSRKSKQHQSSVRNVSTCEVSSSQAISSPQRSKRVKENTPP    771 - 840
RCAMVHSSPACSTSVTCGWGDVASSTTRERQRQTIVIPDTPSPTVSVITISSDTDEEEEQKHAPTSTVSK    841 - 910
QRKNVISCVTVHDSPYSDSSSNTSPYSVQQRAGHNNANAFDTKGSLENHCTGNPRTIIVPPLKTQASEVL    911 - 980
VECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTD    981 - 1050
RTGSHRRQQAYITPTMAQAPYSFPHNSPSHGTVHPHLAAAAAAAHLPTQPHLYTYTAPAALGSTGTVAHL   1051 - 1120
VASQGSARHTVQHTAYPASIVHQVPVSMGPRVLPSPTIHPSQYPAQFAHQTYISASPASTVYTGYPLSPA   1121 - 1190
KVNQYPYI                                                                 1191 - 1198
//

Text Mined References (142)

PMID Year Title
26633710 2015 Genetic ablation of homeodomain-interacting protein kinase 2 selectively induces apoptosis of cerebellar Purkinje cells during adulthood and generates an ataxic-like phenotype.
26247811 2015 Complex regulation of CREB-binding protein by homeodomain-interacting protein kinase 2.
26113041 2016 HIPK2 restricts SIRT1 activity upon severe DNA damage by a phosphorylation-controlled mechanism.
26102034 2015 Lafora disease proteins laforin and malin negatively regulate the HIPK2-p53 cell death pathway.
25961923 2016 MDM4/HIPK2/p53 cytoplasmic assembly uncovers coordinated repression of molecules with anti-apoptotic activity during early DNA damage response.
25944899 2015 The Tyrosine Kinase c-Abl Promotes Homeodomain-interacting Protein Kinase 2 (HIPK2) Accumulation and Activation in Response to DNA Damage.
25868975 2015 HIPK2 deficiency causes chromosomal instability by cytokinesis failure and increases tumorigenicity.
25820028 2015 Programmed cell death 4 protein (Pdcd4) and homeodomain-interacting protein kinase 2 (Hipk2) antagonistically control translation of Hipk2 mRNA.
25778922 2015 NORE1A is a Ras senescence effector that controls the apoptotic/senescent balance of p53 via HIPK2.
25711204 2015 HIPK2 expression in progression of cutaneous epithelial neoplasm.
25630557 2015 Effect of tyrosine autophosphorylation on catalytic activity and subcellular localisation of homeodomain-interacting protein kinases (HIPK).
25552543 2015 Homeodomain-interacting protein kinase 2, a novel autoimmune regulator interaction partner, modulates promiscuous gene expression in medullary thymic epithelial cells.
25421593 2015 miR-141 regulates TGF-?1-induced epithelial-mesenchymal transition through repression of HIPK2 expression in renal tubular epithelial cells.
25313037 2014 XAF1 directs apoptotic switch of p53 signaling through activation of HIPK2 and ZNF313.
25210797 2014 HIPK2 sustains apoptotic response by phosphorylating Che-1/AATF and promoting its degradation.
25151962 2015 Homeodomain-interacting protein kinase 2 regulates DNA damage response through interacting with heterochromatin protein 1?.
24846322 2014 Downregulation of HIPK2 increases resistance of bladder cancer cell to cisplatin by regulating Wip1.
24829283 2014 Interplay between Mdm2 and HIPK2 in the DNA damage response.
24824041 2014 Downregulation of homeodomain-interacting protein kinase-2 contributes to bladder cancer metastasis by regulating Wnt signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270405 2014 Prolyl isomerase Pin1 and protein kinase HIPK2 cooperate to promote cortical neurogenesis by suppressing Groucho/TLE:Hes1-mediated inhibition of neuronal differentiation.
24211575 2013 SIRT1 negatively regulates the protein stability of HIPK2.
24196445 2014 Src kinase modulates the apoptotic p53 pathway by altering HIPK2 localization.
24145406 2013 Autophosphorylation and Pin1 binding coordinate DNA damage-induced HIPK2 activation and cell death.
24107646 2013 Activation of the interleukin-4/signal transducer and activator of transcription 6 signaling pathway and homeodomain-interacting protein kinase 2 production by tonsillar mononuclear cells in IgA nephropathy.
23871434 2013 WIP1, a homeostatic regulator of the DNA damage response, is targeted by HIPK2 for phosphorylation and degradation.
23722549 2013 PML-RAR? and its phosphorylation regulate pml oligomerization and HIPK2 stability.
23703384 2013 Glucose restriction induces cell death in parental but not in homeodomain-interacting protein kinase 2-depleted RKO colon cancer cells: molecular mechanisms and implications for tumor therapy.
23565059 2013 Transcriptional corepressors HIPK1 and HIPK2 control angiogenesis via TGF-?-TAK1-dependent mechanism.
23540226 2013 No associations between rs2030712 and rs7456421 single nucleotide polymorphisms of HIPK2 gene and prevalence of chronic kidney disease. Results of a family-based study.
23144866 2012 Targeting COX-2/PGE(2) pathway in HIPK2 knockdown cancer cells: impact on dendritic cell maturation.
22825850 2012 DNA damage-induced heterogeneous nuclear ribonucleoprotein K sumoylation regulates p53 transcriptional activation.
22689412 2013 Homeodomain-interacting protein kinase2 in human idiopathic pulmonary fibrosis.
22658722 2012 HIPK2 controls cytokinesis and prevents tetraploidization by phosphorylating histone H2B at the midbody.
22503103 2012 A redox-regulated SUMO/acetylation switch of HIPK2 controls the survival threshold to oxidative stress.
22406746 2012 A systems approach identifies HIPK2 as a key regulator of kidney fibrosis.
22395153 2012 Correlation between homeodomain-interacting protein kinase 2 and apoptosis in cervical cancer.
22236966 2012 HIPK2 downregulates vimentin and inhibits breast cancer cell invasion.
22110707 2011 Cutaneous HPV23 E6 prevents p53 phosphorylation through interaction with HIPK2.
21715331 2011 Homeodomain-interacting protein kinase-2 stabilizes p27(kip1) by its phosphorylation at serine 10 and contributes to cell motility.
21602882 2011 HIPK2 phosphorylates ?Np63? and promotes its degradation in response to DNA damage.
21569099 2011 Mutational analysis of the HIPK2 gene in keratoacanthoma and squamous cell carcinoma of the skin.
21514416 2011 Tissue microarray cytometry reveals positive impact of homeodomain interacting protein kinase 2 in colon cancer survival irrespective of p53 function.
21285352 2011 Phosphorylation of TCF proteins by homeodomain-interacting protein kinase 2.
21248371 2011 HIF-1? antagonizes p53-mediated apoptosis by triggering HIPK2 degradation.
21248071 2011 Zyxin is a critical regulator of the apoptotic HIPK2-p53 signaling axis.
21192925 2011 Role of the SUMO-interacting motif in HIPK2 targeting to the PML nuclear bodies and regulation of p53.
21173028 2011 MYCN sensitizes human neuroblastoma to apoptosis by HIPK2 activation through a DNA damage response.
21145359 2011 Control of nuclear HIPK2 localization and function by a SUMO interaction motif.
21057547 2011 AXIN is an essential co-activator for the promyelocytic leukemia protein in p53 activation.
20980392 2010 Transcriptional regulation of ferritin and antioxidant genes by HIPK2 under genotoxic stress.
20940704 2010 The WD40-repeat protein Han11 functions as a scaffold protein to control HIPK2 and MEKK1 kinase functions.
20936779 2010 A human MAP kinase interactome.
20849851 2010 Counteracting MDM2-induced HIPK2 downregulation restores HIPK2/p53 apoptotic signaling in cancer cells.
20637728 2010 Pancreatic and duodenal homeobox 1 (PDX1) phosphorylation at serine-269 is HIPK2-dependent and affects PDX1 subnuclear localization.
20624637 2010 MiR-27a modulates MDR1/P-glycoprotein expression by targeting HIPK2 in human ovarian cancer cells.
20579985 2010 Involvement of the Hipk family in regulation of eyeball size, lens formation and retinal morphogenesis.
20573984 2010 Regulation of genotoxic stress response by homeodomain-interacting protein kinase 2 through phosphorylation of cyclic AMP response element-binding protein at serine 271.
20514025 2010 Regulation of p53 activity by HIPK2: molecular mechanisms and therapeutical implications in human cancer cells.
20418953 2010 Homeodomain interacting protein kinase 2: a target for Alzheimer's beta amyloid leading to misfolded p53 and inappropriate cell survival.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20307497 2010 Homeodomain-interacting protein kinase 2 (HIPK2) targets beta-catenin for phosphorylation and proteasomal degradation.
20234185 2010 HIPK2-a therapeutical target to be (re)activated for tumor suppression: role in p53 activation and HIF-1? inhibition.
20231426 2010 Homeodomain-interacting protein kinase 2 plays an important role in normal terminal erythroid differentiation.
19950553 2009 [Correlation of HIPK2 expression with HPV infection and apoptosis in cervical cancer].
19828042 2009 HIPK2 modulates p53 activity towards pro-apoptotic transcription.
19820693 2009 Methyl-CpG-binding protein 2 is phosphorylated by homeodomain-interacting protein kinase 2 and contributes to apoptosis.
19794125 2009 Alterations of BRAF and HIPK2 loci predominate in sporadic pilocytic astrocytoma.
19788416 2009 Apoptosis and autophagy: Regulation of apoptosis by DNA damage signalling - roles of p53, p73 and HIPK2.
19714248 2009 Targeting hypoxia in cancer cells by restoring homeodomain interacting protein-kinase 2 and p53 activity and suppressing HIF-1alpha.
19668373 2009 Homeodomain interacting protein kinase 2 activation compromises endothelial cell response to laminar flow: protective role of p21(waf1,cip1,sdi1).
19567674 2009 Negative regulation of beta4 integrin transcription by homeodomain-interacting protein kinase 2 and p53 impairs tumor progression.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19448668 2009 The human protein kinase HIPK2 phosphorylates and downregulates the methyl-binding transcription factor ZBTB4.
19438900 2009 HIPK2 is involved in cell proliferation and its suppression promotes growth arrest independently of DNA damage.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19128456 2009 Inhibition of HIF-1alpha activity by homeodomain-interacting protein kinase-2 correlates with sensitization of chemoresistant cells to undergo apoptosis.
19046997 2009 Transcriptional regulation of hypoxia-inducible factor 1alpha by HIPK2 suggests a novel mechanism to restrain tumor growth.
19043406 2009 An inducible autoregulatory loop between HIPK2 and Siah2 at the apex of the hypoxic response.
19015637 2009 PML tumor suppressor is regulated by HIPK2-mediated phosphorylation in response to DNA damage.
18996371 2009 Restoring wtp53 activity in HIPK2 depleted MCF7 cells by modulating metallothionein and zinc.
18974774 2009 How cells switch HIPK2 on and off.
18809579 2008 PML activates transcription by protecting HIPK2 and p300 from SCFFbx3-mediated degradation.
18695000 2008 PEBP2-beta/CBF-beta-dependent phosphorylation of RUNX1 and p300 by HIPK2: implications for leukemogenesis.
18644116 2008 Regulation of vascular endothelial growth factor expression by homeodomain-interacting protein kinase-2.
18536714 2008 Control of HIPK2 stability by ubiquitin ligase Siah-1 and checkpoint kinases ATM and ATR.
18483253 2008 Reversible dysfunction of wild-type p53 following homeodomain-interacting protein kinase-2 knockdown.
18408760 2008 High-resolution, dual-platform aCGH analysis reveals frequent HIPK2 amplification and increased expression in pilocytic astrocytomas.
18395248 2008 Overexpression of HIPK2 circumvents the blockade of apoptosis in chemoresistant ovarian cancer cells.
18093972 2008 Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WD40 repeat/SOCS box protein WSB-1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17960875 2007 Homeodomain-interacting protein kinase-2 (HIPK2) phosphorylates HMGA1a at Ser-35, Thr-52, and Thr-77 and modulates its DNA binding affinity.
17627287 2007 HIPK2-induced p53Ser46 phosphorylation activates the KILLER/DR5-mediated caspase-8 extrinsic apoptotic pathway.
17533375 2007 Mutations of the HIPK2 gene in acute myeloid leukemia and myelodysplastic syndrome impair AML1- and p53-mediated transcription.
17349959 2007 MDM2-regulated degradation of HIPK2 prevents p53Ser46 phosphorylation and DNA damage-induced apoptosis.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17332358 2007 Homeodomain-interacting protein kinase 2 is the ionizing radiation-activated p53 serine 46 kinase and is regulated by ATM.
17245128 2007 HIPK2: a versatile switchboard regulating the transcription machinery and cell death.
17018294 2006 Phosphorylation-dependent control of Pc2 SUMO E3 ligase activity by its substrate protein HIPK2.
16917507 2006 Roles of HIPK1 and HIPK2 in AML1- and p300-dependent transcription, hematopoiesis and blood vessel formation.
16738336 2006 Repression of the antiapoptotic molecule galectin-3 by homeodomain-interacting protein kinase 2-activated p53 is required for p53-induced apoptosis.
16601678 2006 Autoregulatory control of the p53 response by caspase-mediated processing of HIPK2.
16467083 2006 Homeodomain-interacting protein kinase-2 restrains cytosolic phospholipase A2-dependent prostaglandin E2 generation in human colorectal cancer cells.
16407227 2006 Phosphorylation and transactivation of Pax6 by homeodomain-interacting protein kinase 2.
16343438 2006 FHL2 mediates p53-induced transcriptional activation through a direct association with HIPK2.
16253240 2005 Desumoylation of homeodomain-interacting protein kinase 2 (HIPK2) through the cytoplasmic-nuclear shuttling of the SUMO-specific protease SENP1.
16212962 2005 HIPK2 inhibits both MDM2 gene and protein by, respectively, p53-dependent and independent regulations.
15958389 2005 Regulation of homeodomain-interacting protein kinase 2 (HIPK2) effector function through dynamic small ubiquitin-related modifier-1 (SUMO-1) modification.
15896780 2005 Differential interactions of the homeodomain-interacting protein kinase 2 (HIPK2) by phosphorylation-dependent sumoylation.
15766567 2005 Covalent modification of human homeodomain interacting protein kinase 2 by SUMO-1 at lysine 25 affects its stability.
15708980 2005 Homeodomain-interacting protein kinase-2 mediates CtBP phosphorylation and degradation in UV-triggered apoptosis.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15122315 2004 HIPK2 neutralizes MDM2 inhibition rescuing p53 transcriptional activity and apoptotic function.
15082531 2004 Wnt-1 signal induces phosphorylation and degradation of c-Myb protein via TAK1, HIPK2, and NLK.
14990717 2004 US11 of herpes simplex virus type 1 interacts with HIPK2 and antagonizes HIPK2-induced cell growth arrest.
14678985 2003 HIPK2 regulates transforming growth factor-beta-induced c-Jun NH(2)-terminal kinase activation and apoptosis in human hepatoma cells.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14647468 2003 Sp100 is important for the stimulatory effect of homeodomain-interacting protein kinase-2 on p53-dependent gene expression.
14626429 2003 Viruses as hijackers of PML nuclear bodies.
14609633 2003 Association of the nucleocapsid protein of the Seoul and Hantaan hantaviruses with small ubiquitin-like modifier-1-related molecules.
12907596 2003 PML is required for homeodomain-interacting protein kinase 2 (HIPK2)-mediated p53 phosphorylation and cell cycle arrest but is dispensable for the formation of HIPK domains.
12874272 2003 Requirement of the co-repressor homeodomain-interacting protein kinase 2 for ski-mediated inhibition of bone morphogenetic protein-induced transcriptional activation.
12853948 2003 The DNA sequence of human chromosome 7.
12851404 2003 TP53INP1s and homeodomain-interacting protein kinase-2 (HIPK2) are partners in regulating p53 activity.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220523 2002 HIPK2 associates with RanBPM.
11925430 2002 Identification and characterization of HIPK2 interacting with p73 and modulating functions of the p53 family in vivo.
11798164 2002 The homeodomain-interacting protein kinase 2 gene is expressed late in embryogenesis and preferentially in retina, muscle, and neural tissues.
11780126 2002 Homeodomain-interacting protein kinase-2 phosphorylates p53 at Ser 46 and mediates apoptosis.
11740489 2002 Regulation of p53 activity by its interaction with homeodomain-interacting protein kinase-2.
11593421 2001 High mobility group I (Y) proteins bind HIPK2, a serine-threonine kinase protein which inhibits cell growth.
11438542 2001 The DNA glycosylase T:G mismatch-specific thymine DNA glycosylase represses thyroid transcription factor-1-activated transcription.
11267674 2001 Isolation and characterization of cDNAs for the protein kinase HIPK2.
11120354 2000 Human homeodomain-interacting protein kinase-2 (HIPK2) is a member of the DYRK family of protein kinases and maps to chromosome 7q32-q34.
11032752 2000 The serine/threonine kinase HIPK2 interacts with TRADD, but not with CD95 or TNF-R1 in 293T cells.
10559189 1999 The homeodomain protein NK-3 recruits Groucho and a histone deacetylase complex to repress transcription.
10535925 1999 Covalent modification of the homeodomain-interacting protein kinase 2 (HIPK2) by the ubiquitin-like protein SUMO-1.
9847074 1998 Toward a complete human genome sequence.
9748262 1998 Homeodomain-interacting protein kinases, a novel family of co-repressors for homeodomain transcription factors.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.