Property Summary

NCBI Gene PubMed Count 28
PubMed Score 37.76
PubTator Score 56.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
chronic lymphocytic leukemia -1.500 5.9e-04
malignant mesothelioma -1.200 4.7e-06
oligodendroglioma 1.700 1.1e-02
osteosarcoma -2.271 4.0e-05
medulloblastoma, large-cell -1.500 3.3e-04
adrenocortical carcinoma -1.236 1.9e-04
tuberculosis -1.400 7.3e-06
intraductal papillary-mucinous carcinoma... 1.100 2.6e-03
atypical teratoid/rhabdoid tumor -1.100 5.0e-04
pilocytic astrocytoma 1.100 1.9e-03
subependymal giant cell astrocytoma -1.177 2.1e-02
pituitary cancer -2.100 3.9e-10

Gene RIF (17)

PMID Text
26341140 We conclude that HIP1R expression is strongly indicative of survival in diffuse large B-cell lymphoma
25818163 our findings support the conclusion that the rs12817488 in CCDC62/HIP1R polymorphism may increase the risk of Parkinson's disease in the Chinese Han population.
24312176 STK39 (rs2102808) and CCDC62/HIP1R (rs12817488) do not appear to influence PD risk.
21189155 HIP1r plays an important role in regulating the attachment of spindle microtubules to chromosomes during mitosis, an event that is required for accurate congression and segregation of chromosomes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19255499 This study provided the previously unknown function of HIP1R involved in the intrinsic cell death pathway and further explored possible mechanisms by which HIP1R induces cell death.
18790740 Actin binding by Hip1 (huntingtin-interacting protein 1) and Hip1R (Hip1-related protein) is regulated by clathrin light chain
18187620 Knockdown of huntingtin interacting protein 1 related (HIP1R) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18165318 in mammalian cells CLCs function in intracellular membrane trafficking by acting as recruitment proteins for HIP1R, enabling HIP1R to regulate actin assembly on clathrin-coated structures
17928447 Neuronal dysfunction in transgenic Caenorhabditis elegans expressing mutant N-terminal huntingtin is specifically enhanced by hipr-1 loss of function.
17452370 Human HIP1 transgenic Hip1/Hip1r knockout mice are completely free from dwarfism and spinal defects.
16415883 characterize the F-actin-binding region of HIP1R, termed the talin-HIP1/R/Sla2p actin-tethering C-terminal homology (THATCH) domain
15588756 the stability of intergenerational transmission of a variable number tandem repeat (VNTR) polymorphism, found in the Huntingtin interacting protein-1 related gene (HIP12/HIP1R) that is mapped to the chromosome 12q24.31 region.
15581353 The F-actin binding capacity of Hip12 is regulated by intrasteric occlusion of primary actin-binding determinants within the Hip12 I/LWEQ module.
14742709 Hip1R has a role in making the interaction between actin and the endocytic machinery functional and transient
14732715 both HIP1r and HIP1 bind inositol lipids via their epsin N-terminal homology (ENTH) domains
11889126 HIP1 and HIP12 display differential binding to F-actin, AP2, and clathrin. Identification of a novel interaction with clathrin light chain. (HIP12)

AA Sequence

MNSIKNVPARVLSRRPGHSLEAEREQFDKTQAISISKAINTQEAPVKEKHARRIILGTHHEKGAFTFWSY      1 - 70
AIGLPLPSSSILSWKFCHVLHKVLRDGHPNVLHDCQRYRSNIREIGDLWGHLHDRYGQLVNVYTKLLLTK     71 - 140
ISFHLKHPQFPAGLEVTDEVLEKAAGTDVNNIFQLTVEMFDYMDCELKLSESVFRQLNTAIAVSQMSSGQ    141 - 210
CRLAPLIQVIQDCSHLYHYTVKLLFKLHSCLPADTLQGHRDRFHEQFHSLRNFFRRASDMLYFKRLIQIP    211 - 280
RLPEGPPNFLRASALAEHIKPVVVIPEEAPEDEEPENLIEISTGPPAGEPVVVADLFDQTFGPPNGSVKD    281 - 350
DRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLRHELAQLR    351 - 420
AAQLEGERSQGLREEAERKASATEARYNKLKEKHSELVHVHAELLRKNADTAKQLTVTQQSQEEVARVKE    421 - 490
QLAFQVEQVKRESELKLEEKSDQLEKLKRELEAKAGELARAQEALSHTEQSKSELSSRLDTLSAEKDALS    491 - 560
GAVRQREADLLAAQSLVRETEAALSREQQRSSQEQGELQGRLAERESQEQGLRQRLLDEQFAVLRGAAAE    561 - 630
AAGILQDAVSKLDDPLHLRCTSSPDYLVSRAQEALDAVSTLEEGHAQYLTSLADASALVAALTRFSHLAA    631 - 700
DTIINGGATSHLAPTDPADRLIDTCRECGARALELMGQLQDQQALRHMQASLVRTPLQGILQLGQELKPK    701 - 770
SLDVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTT    771 - 840
STSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEI    841 - 910
AASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSGLSLIKLKKQE    911 - 980
METQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPGEEVAIRPSTAPRSVTTKKPPLAQKPSVAPRQ    981 - 1050
DHQLDKKDGIYPAQLVNY                                                       1051 - 1068
//

Text Mined References (35)

PMID Year Title
26341140 2015 Low HIP1R mRNA and protein expression are associated with worse survival in diffuse large B-cell lymphoma patients treated with R-CHOP.
25818163 2015 The single nucleotide polymorphism Rs12817488 is associated with Parkinson's disease in the Chinese population.
24312176 2013 Genetic association study between STK39 and CCDC62/HIP1R and Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21292315 2011 Imputation of sequence variants for identification of genetic risks for Parkinson's disease: a meta-analysis of genome-wide association studies.
21269460 2011 Initial characterization of the human central proteome.
21189155 2010 Huntingtin-interacting protein 1-related is required for accurate congression and segregation of chromosomes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20074057 2010 The Sla2p/HIP1/HIP1R family: similar structure, similar function in endocytosis?
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19255499 2009 HIP1R interacts with a member of Bcl-2 family, BCL2L10, and induces BAK-dependent cell death.
18790740 2008 Actin binding by Hip1 (huntingtin-interacting protein 1) and Hip1R (Hip1-related protein) is regulated by clathrin light chain.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18165318 2008 Clathrin light chains function in mannose phosphate receptor trafficking via regulation of actin assembly.
17928447 2007 Huntingtin-interacting protein 1 influences worm and mouse presynaptic function and protects Caenorhabditis elegans neurons against mutant polyglutamine toxicity.
17452370 2007 Degenerative phenotypes caused by the combined deficiency of murine HIP1 and HIP1r are rescued by human HIP1.
17318189 2007 A Hip1R-cortactin complex negatively regulates actin assembly associated with endocytosis.
16541075 2006 The finished DNA sequence of human chromosome 12.
16415883 2006 Structural definition of the F-actin-binding THATCH domain from HIP1R.
15588756 2004 Analysis of a variable number tandem repeat polymorphism in the huntingtin interacting protein-1 related gene for anticipation in bipolar affective disorder.
15581353 2004 Intrasteric inhibition mediates the interaction of the I/LWEQ module proteins Talin1, Talin2, Hip1, and Hip12 with actin.
15533940 2005 Huntingtin-interacting protein 1 (Hip1) and Hip1-related protein (Hip1R) bind the conserved sequence of clathrin light chains and thereby influence clathrin assembly in vitro and actin distribution in vivo.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14742709 2004 RNAi-mediated Hip1R silencing results in stable association between the endocytic machinery and the actin assembly machinery.
14732715 2004 HIP1 and HIP1r stabilize receptor tyrosine kinases and bind 3-phosphoinositides via epsin N-terminal homology domains.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12650982 2003 Huntingtin-interacting protein-1-related protein of rat (rHIP1R) is localized in the postsynaptic regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11889126 2002 HIP1 and HIP12 display differential binding to F-actin, AP2, and clathrin. Identification of a novel interaction with clathrin light chain.
11063258 2000 HIP12 is a non-proapoptotic member of a gene family including HIP1, an interacting protein with huntingtin.
9852681 1998 Cloning, expression analysis, and chromosomal localization of HIP1R, an isolog of huntingtin interacting protein (HIP1).
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
1189126 1975 Caliceal urodynamics.