1. Home
  2. Targets
  3. nucleic acid binding
  4. DNA binding protein
  5. damaged DNA-binding protein
  6. Histidine triad nucleotide-binding protein 3

Tdark Histidine triad nucleotide-binding protein 3

Hydrolyzes phosphoramidate and acyl-adenylate substrates.

Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM, Mar 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.84
PubTator Score 1.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (21)

Disease log2 FC p
hepatocellular carcinoma 1.600 8.0e-04
pancreatic cancer 1.700 3.3e-02
osteosarcoma 1.473 2.3e-02
ependymoma -1.200 2.4e-06
group 4 medulloblastoma 2.100 7.9e-06
atypical teratoid / rhabdoid tumor -1.500 3.7e-03
glioblastoma -1.300 5.0e-03
medulloblastoma, large-cell -2.400 8.6e-05
autosomal dominant Emery-Dreifuss muscul... -1.293 4.3e-02
limb girdle muscular dystrophy 2B -1.587 3.4e-03
Amyotrophic Lateral Sclerosis -1.245 6.2e-03
tuberculosis and treatment for 6 months 1.100 1.0e-03
non-small cell lung cancer -1.654 2.5e-15
Breast cancer 2.800 2.9e-02
adult high grade glioma -1.400 1.0e-03
non primary Sjogren syndrome sicca 1.300 1.4e-02
pancreatic carcinoma 1.700 3.3e-02
psoriasis -1.200 8.8e-21
ductal carcinoma in situ -1.600 2.0e-03
invasive ductal carcinoma -1.800 4.0e-04
ovarian cancer -1.100 2.0e-03

Synonym

Accession Q9NQE9 B3KQ91 Q8N0Y9 HINT-3
Symbols HINT4

Gene

HINT3

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (8)

 GO Function (2)

 GO Component (3)

 Compartment GO Term (21)

See all...

 HCA RNA Cell Line (56)

See all...

Pathway (1)

Protein-protein Interaction (11)

GCC2   UBP1   TFCP2   SMAD2   SMAD3   NUCB1   HINT1   DGCR14   FBXO7   DHRS3   MID1IP1  

Gene RIF (1)

PMID Text
17870088 Results show that significant differences in phosphoramidase activity, oligomeric state, and cellular localization suggest that Hint3s should be placed in a distinct branch of the histidine triad superfamily.

AA Sequence 

MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENED      1 - 70
LICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCS     71 - 140
ISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT                                141 - 182
//

Text Mined References (14)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17870088 2007 Evidence that human histidine triad nucleotide binding protein 3 (Hint3) is a distinct branch of the histidine triad (HIT) superfamily.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12119013 2002 Hint, Fhit, and GalT: function, structure, evolution, and mechanism of three branches of the histidine triad superfamily of nucleotide hydrolases and transferases.
11805111 2002 Adenosine monophosphoramidase activity of Hint and Hnt1 supports function of Kin28, Ccl1, and Tfb3.