Property Summary

NCBI Gene PubMed Count 11
PubMed Score 22.79
PubTator Score 8.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.429 2.7e-03
tuberculosis 1.200 2.4e-08

Gene RIF (4)

PMID Text
23682076 Low HINT2 expression is associated with low response to therapy in endometrial cancer.
23659632 X-ray crystal structure of human HINT2 with and without bound AMP.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18653718 Hint2 is required for an optimal steroidogenic response, possibly because of a particular signalling function exerted within the mitochondria.

AA Sequence

MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILY      1 - 70
EDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKL     71 - 140
GAQSVYHLHIHVLGGRQLQWPPG                                                   141 - 163
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23682076 2013 Progesterone enhances calcitriol antitumor activity by upregulating vitamin D receptor expression and promoting apoptosis in endometrial cancer cells.
23659632 2013 Structural characterization of human histidine triad nucleotide-binding protein 2, a member of the histidine triad superfamily.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18653718 2008 Hint2 is expressed in the mitochondria of H295R cells and is involved in steroidogenesis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16762638 2006 Hint2, a mitochondrial apoptotic sensitizer down-regulated in hepatocellular carcinoma.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12119013 2002 Hint, Fhit, and GalT: function, structure, evolution, and mechanism of three branches of the histidine triad superfamily of nucleotide hydrolases and transferases.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.