Property Summary

NCBI Gene PubMed Count 16
PubMed Score 12.61
PubTator Score 6.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia -1.300 4.2e-02
ovarian cancer 1.600 5.3e-05

Synonym

Accession Q53FT3 Q8WVE8 Q9NVQ2 Q9NZZ1 Q9P022 Q9P0N1
Symbols HLD13
L7RN6
OPI10
HSPC138
HSPC179
C11orf73

Gene

PDB

3WVZ   3WW0  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLL      1 - 70
GFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQ     71 - 140
FTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT                 141 - 197
//

Text Mined References (18)

PMID Year Title