Property Summary

NCBI Gene PubMed Count 16
PubMed Score 12.61
PubTator Score 6.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia -1.300 4.2e-02
ovarian cancer 1.600 5.3e-05

Gene RIF (4)

AA Sequence

MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLL      1 - 70
GFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQ     71 - 140
FTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT                 141 - 197
//

Text Mined References (18)

PMID Year Title