Putative HIG1 domain family member 2B

Property Summary

NCBI Gene PubMed Count	1
PubMed Score	0.00

Knowledge Summary

Patent

No data available

Expression

Specificity
Differential

Testis 18,518

Brain - Spinal cord (cervical c-1) 17,973

Minor Salivary Gland 18,005

Lung 18,057

Skin - Not Sun Exposed (Suprapubic) 18,081

Prostate 18,213

Colon - Transverse 17,825

Esophagus - Mucosa 18,076

Cells - EBV-transformed lymphocytes 18,186

Adrenal Gland 18,071

Artery - Coronary 17,949

Ovary 17,971

Thyroid 18,024

Pituitary 18,147

Breast - Mammary Tissue 18,103

Cells - Transformed fibroblasts 17,577

Brain - Frontal Cortex (BA9) 18,069

Nerve - Tibial 18,007

Small Intestine - Terminal Ileum 17,954

Esophagus - Muscularis 18,017

Artery - Tibial 17,631

Brain - Amygdala 18,006

Stomach 17,879

Spleen 17,614

Adipose - Visceral (Omentum) 17,937

Skin - Sun Exposed (Lower leg) 17,968

Kidney - Cortex 17,329

Brain - Cortex 18,039

Heart - Atrial Appendage 17,896

Whole Blood 17,439

Pancreas 18,123

Esophagus - Gastroesophageal Junction 18,000

Vagina 17,834

Brain - Substantia nigra 17,981

Brain - Hypothalamus 18,169

Brain - Cerebellar Hemisphere 18,015

Heart - Left Ventricle 18,006

Brain - Anterior cingulate cortex (BA24) 17,989

Liver 18,071

Adipose - Subcutaneous 18,110

Brain - Putamen (basal ganglia) 17,863

Brain - Caudate (basal ganglia) 18,001

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Hippocampus 18,011

Muscle - Skeletal 17,778

epididymis 15,863

testis 17,936

thyroid gland 15,959

Endocrine System 18,159

Male tissues 17,142

Brain 7,346

Synonym

Accession	Q4VC39
Symbols	HIGD2BP

Gene

HIGD2B

Ortholog (1)

Species	Source	Disease
Chimp	OMA EggNOG

UniProt Keyword (5)

Complete proteome 20,231

Reference proteome 20,231

Membrane 7,361

Transmembrane 5,228

Transmembrane helix 5,207

GO Component (1)

integral component of membrane 3,665

Compartment GO Term (5)

Integral component of membrane 5,330

Intrinsic component of membrane 5,457

Membrane 8,530

Membrane part 6,553

cellular_component 18,320

HCA RNA Cell Line (23)

A549 15,174

AN3-CA 15,648

ASC TERT1 14,842

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ RasG12V 15,493

CACO-2 15,436

CAPAN-2 16,102

EFO-21 17,301

HaCaT 16,515

HeLa 15,690

See all...

AA Sequence

MATLGFVTPEAPFESSKPPIFEGLSPTVYSNPEGFKEKFLRKTRENPVVPIGFLCTAAVLTNGLYCFHQG      1 - 70
NSQCSRLMMHTQIAAQGFTIAAILLGLAATAMKSPP                                       71 - 106
//

Text Mined References (2)

Summary
Details

	PMID	Year	Title