Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.39

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSSDNQWSADEDEGQLSRLIRKSRDSPFVPIGIAGFVTVVSCGLYKLKYRRDQKMSIHLIHMRVAAQGFV      1 - 70
VGAVTLGVLYSMYKDYIRPRFFSESKK                                                71 - 97
//

Text Mined References (3)

PMID Year Title