Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.38
PubTator Score 4.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 1.3e-02
ependymoma -1.200 3.2e-02
intraductal papillary-mucinous adenoma (... -1.500 2.1e-04
intraductal papillary-mucinous carcinoma... -1.400 7.2e-04
intraductal papillary-mucinous neoplasm ... -1.400 4.1e-03
lung adenocarcinoma -2.000 8.2e-17
lung cancer -1.400 1.3e-03
medulloblastoma, large-cell -1.500 5.7e-06
non-small cell lung cancer -2.721 5.8e-36
pituitary cancer 1.700 3.1e-09

AA Sequence

MSANRRWWVPPDDEDCVSEKLLRKTRESPLVPIGLGGCLVVAAYRIYRLRSRGSTKMSIHLIHTRVAAQA      1 - 70
CAVGAIMLGAVYTMYSDYVKRMAQDAGEK                                              71 - 99
//

Text Mined References (8)

PMID Year Title