Property Summary

NCBI Gene PubMed Count 32
PubMed Score 313.86
PubTator Score 111.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma 6.600 2.3e-10
astrocytic glioma 1.500 2.9e-02
oligodendroglioma 1.700 3.3e-02
psoriasis -2.200 6.2e-04
osteosarcoma 1.404 4.6e-02
ependymoma 1.600 8.1e-03
glioblastoma 2.300 1.1e-04
medulloblastoma -2.000 1.9e-03
atypical teratoid / rhabdoid tumor 3.200 5.5e-06
medulloblastoma, large-cell 3.000 8.2e-05
non-small cell lung carcinoma -1.300 2.4e-30
colon cancer -3.600 1.2e-02
lung cancer -5.500 1.8e-06
Breast cancer -4.400 2.2e-02
interstitial cystitis -1.300 6.5e-03
adult high grade glioma 1.800 1.4e-02
lung adenocarcinoma -2.100 7.5e-11
Alzheimer's disease 1.300 4.9e-02
Pick disease 2.500 3.9e-04
ductal carcinoma in situ -1.500 3.6e-04
invasive ductal carcinoma -1.700 2.1e-03
ovarian cancer 1.700 1.2e-10
pituitary cancer -3.400 6.4e-07

Protein-protein Interaction (2)

Gene RIF (22)

PMID Text
26717317 HIF3A DNA Methylation Is Associated with Childhood Obesity and ALT
26237540 Unsaturated fatty acids are high-affinity ligands of the C-terminal domain from the HIF-3alpha.
26174816 inverse association with hypertrophic markers in chondrogenic cells
26011824 The association between increased DNA methylation at HIF3A and increased adiposity is present in neonates.
26001398 A DNA methylation variant in HIF3A was associated with BMI changes through interactions with total or supplemental vitamin B2, vitamin B12, and folate.
25936862 HIF3alpha has a transcriptional regulatory function, which negatively affects gene expression by competing with HIF1alpha and HIF2alpha in binding to transcriptional elements in target genes during hypoxia. (Review)
24927770 Here we provide evidence for the miRNA mediated regulation of HIF3a by hypoxia responsive miRNAs in STS, which may help to tightly regulate and fine-tune the hypoxic response.
24371328 These findings highlight the importance of the hypoxia-sensing pathway and HIFs in clinical hematology.
24092767 The Inhibitory Per/Arnt/Sim (PAS) domain protein (IPAS) is a splice variant of hypoxia-inducible factor (HIF)-3alpha, and possesses two entirely different functions. The results strongly suggest that IPAS is a nucleocytoplasmic shuttling protein.
23485455 the transcription of HIF-3alpha4 was silenced by the promoter DNA methylation in meningiomas, and inducible HIF-3alpha4 impaired angiogenesis, proliferation, and metabolism/oxidation in hypervascular meningiomas
23451260 Were significantly upregulated in the HIF3alpha expressing lungs.
21479871 data indicate that the HIF-3alpha variants may have more versatile and specific roles in the regulation of the hypoxia response than previously anticipated
21404626 It is a negative regulator of tumorigenesis. (review)
21069422 Cell-specific and hypoxia-dependent regulation of human HIF-3alpha.
20551700 HIF3A is regulated by hypoxia in the developing human lung.
20416395 Hypoxia upregulated transcription from all three alternative HIF-3alpha promoters. siRNA experiments showed that this induction is mediated specifically by HIF-1 and not by HIF-2.
19694616 The findings shed light on a novel aspect of HIF-3alpha as a HIF-1 target gene and point to a possible role as a modulator of hypoxic gene induction.
17998805 The expression of HIF-3alpha4 suppresses the growth of tumor xenografts in SCID mice.
16775626 findings suggest that HIF-3alpha, as a member of the HIF system, is complementary rather than redundant to HIF-1alpha induction in protection against hypoxic damage in alveolar epithelial cells.
16182248 IPAS1 and IPAS2 inhibit angiogenesis by binding to and inhibiting HIF-1alpha and HIF-1beta.
16126907 The splice isoform HIF-3alpha4 inhibits transcription of VEGF and GLUT1 by binding to and inhibiting HIF-1alpha and HIF-1beta.
12538644 multiple splice variants of locus are targets of the von Hippel-Lindau E3 ubiquitin ligase complex

AA Sequence

MALGLQRARSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTISYLRMHRLC      1 - 70
AAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLSQLELIGHSIFDFIHPCDQEE     71 - 140
LQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRGRTLNLKAATWKVLNCSGHMRAYKPPAQTSPAGSP    141 - 210
DSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHA    211 - 280
LDSDAVSKSIHTLLSKGQAVTGQYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISQVEETGVV    281 - 350
LSLEQTEQHSRRPIQRGAPSQKDTPNPGDSLDTPGPRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGP    351 - 420
ILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALDLEML    421 - 490
APYISMDDDFQLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALEPSLLPRWGSDPRLSCSSPSRGDPS    491 - 560
ASSPMAGARKRTLAQSSEDEDEGVELLGVRPPKRSPSPEHENFLLFPLSLSFLLTGGPAPGSLQDPSTPL    561 - 630
LNLNEPLGLGPSLLSPYSDEDTTQPGGPFQPRAGSAQAD                                   631 - 669
//

Text Mined References (34)

PMID Year Title
26717317 2015 HIF3A DNA Methylation Is Associated with Childhood Obesity and ALT.
26237540 2015 Unsaturated fatty acids as high-affinity ligands of the C-terminal Per-ARNT-Sim domain from the Hypoxia-inducible factor 3?.
26174816 2015 Hypoxia-inducible factor 3-alpha expression is associated with the stable chondrocyte phenotype.
26011824 2015 HIF3A association with adiposity: the story begins before birth.
26001398 2015 DNA Methylation Variants at HIF3A Locus, B-Vitamin Intake, and Long-term Weight Change: Gene-Diet Interactions in Two U.S. Cohorts.
25936862 2015 Progress on hypoxia-inducible factor-3: Its structure, gene regulation and biological function (Review).
24927770 2014 MicroRNA response to hypoxic stress in soft tissue sarcoma cells: microRNA mediated regulation of HIF3?.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24371328 2014 Targeting the hypoxia-sensing pathway in clinical hematology.
24092767 2013 Nucleocytoplasmic shuttling of IPAS by its unique nuclear import and export signals unshared with other HIF-3? splice variants.
23485455 2013 A hypoxia-inducible factor (HIF)-3? splicing variant, HIF-3?4 impairs angiogenesis in hypervascular malignant meningiomas with epigenetically silenced HIF-3?4.
23451260 2013 Hypoxia inducible factor 3? plays a critical role in alveolarization and distal epithelial cell differentiation during mouse lung development.
21479871 2011 Roles of the human hypoxia-inducible factor (HIF)-3? variants in the hypoxia response.
21404626 2011 [Hypoxia-inducible factor-3alpha as a negative regulator of tumorigenesis].
21069422 2011 Cell-specific and hypoxia-dependent regulation of human HIF-3?: inhibition of the expression of HIF target genes in vascular cells.
20551700 2010 Effect of oxygen on the expression of hypoxia-inducible factors in human fetal lung explants.
20416395 2010 Hypoxia-inducible factor (HIF)-3alpha is subject to extensive alternative splicing in human tissues and cancer cells and is regulated by HIF-1 but not HIF-2.
19694616 2009 The human HIF (hypoxia-inducible factor)-3alpha gene is a HIF-1 target gene and may modulate hypoxic gene induction.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17998805 2007 Dominant-negative HIF-3 alpha 4 suppresses VHL-null renal cell carcinoma progression.
17121608 2006 Comparative mapping reveals multiple rearrangements between pig chromosome 6 and human 19q13.
16775626 2006 Hypoxia upregulates hypoxia inducible factor (HIF)-3alpha expression in lung epithelial cells: characterization and comparison with HIF-1alpha.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16182248 2005 Binding and regulation of hypoxia-inducible factor-1 by the inhibitory PAS proteins.
16126907 2005 Human HIF-3alpha4 is a dominant-negative regulator of HIF-1 and is down-regulated in renal cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12538644 2003 Multiple splice variants of the human HIF-3 alpha locus are targets of the von Hippel-Lindau E3 ubiquitin ligase complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12119283 2002 Inhibitory PAS domain protein (IPAS) is a hypoxia-inducible splicing variant of the hypoxia-inducible factor-3alpha locus.
11734856 2001 Inhibitory PAS domain protein is a negative regulator of hypoxia-inducible gene expression.
11573933 2001 Expression and characterization of hypoxia-inducible factor (HIF)-3alpha in human kidney: suppression of HIF-mediated gene expression by HIF-3alpha.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.