Property Summary

Ligand Count 43
NCBI Gene PubMed Count 2,554
PubMed Score 3234.04
PubTator Score 5115.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (19)

Disease log2 FC p
glioblastoma 1.400 5.0e-03
acute quadriplegic myopathy 1.570 9.2e-05
Amyotrophic lateral sclerosis 1.063 1.0e-04
astrocytic glioma 1.200 2.5e-02
autosomal dominant Emery-Dreifuss muscul... 1.490 5.6e-03
breast carcinoma 1.500 6.5e-04
chronic lymphosyte leukemia -1.800 1.6e-04
dermatomyositis 1.600 2.0e-03
diabetes mellitus -1.600 4.6e-02
Duchenne muscular dystrophy 1.570 3.1e-06
ductal carcinoma in situ 1.100 7.7e-04
gastric carcinoma 1.200 1.4e-02
juvenile dermatomyositis 1.970 1.3e-11
oligodendroglioma 1.400 3.7e-02
osteosarcoma 1.656 1.9e-05
pancreatic cancer 1.500 3.3e-03
primary pancreatic ductal adenocarcinoma 1.498 7.7e-03
psoriasis 1.100 3.6e-49
ulcerative colitis 1.400 2.1e-10

 GWAS Trait (1)

Protein-protein Interaction (11)

PDB (18)

Gene RIF (2485)

AA Sequence

MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVR      1 - 70
KLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCD     71 - 140
HEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQC    141 - 210
GYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYH    211 - 280
ALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDL    281 - 350
IFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET    351 - 420
DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFT    421 - 490
MPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLE    491 - 560
MLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKD    561 - 630
RMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTT    631 - 700
VPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKT    701 - 770
IILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN                  771 - 826
//

Text Mined References (2565)

PMID Year Title