Property Summary

NCBI Gene PubMed Count 54
PubMed Score 104.03
PubTator Score 91.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cystic fibrosis -1.295 6.5e-05
atypical teratoid / rhabdoid tumor 1.500 2.7e-05
glioblastoma 1.300 1.5e-04
medulloblastoma, large-cell 1.100 3.3e-03
adrenocortical carcinoma -1.051 3.1e-05
primary pancreatic ductal adenocarcinoma 1.378 1.5e-02
tuberculosis -1.200 8.3e-04
pilocytic astrocytoma 1.300 7.9e-04
invasive ductal carcinoma -1.800 4.4e-04

Gene RIF (48)

PMID Text
26510908 Epigenetic silencing of HIC1 promotes epithelial-mesenchymal transition and drives progression in esophageal squamous cell carcinoma via EphA2 signaling.
25934696 The tumor-suppressive function of Hic1 in colon is related to its inhibitory action on proproliferative signaling mediated by the Tlr2 receptor present on tumor cells.
24992983 Results demonstrated an important role of HIC1 for the normal progression of cell cycle, and could affect the homeostasis of p53 as well as number of cell cycle-related genes, which may or may not be directly linked to p53.
24907396 We found that EVI1 and HIC1 colocalize in the nucleus, and their interaction is mediated by the amino terminal zinc finger binding domain of EVI1
24489730 HIC-1 expression was assessed on a tissue microarray containing 80 cases of breast cancer.
24295734 HIC1 silencing in triple-negative breast cancer drives progression through misregulation of LCN2.
24076391 ectopic expression of HIC1 in U2OS and MDA-MB-231 cell lines decreases expression of the ApoER2 and VLDLR genes, encoding two canonical tyrosine kinase receptors for Reelin.
24067369 HIC1 interacts with and modulates the transcriptional activity of STAT3.
23769968 Reactivation of HIC1 suppressed cell migration and induced cell cycle arrest in the G0/G1 phase, as well as induced apoptosis in gastric cancer cells.
23417673 epigenetic HIC1 inactivation, which is an early step in tumorigenesis, could contribute to the accumulation of DNA mutations through impaired DNA repair and thus favor tumorigenesis.
23340301 Our data show for the first time that hypermethylation of HIC1 promoter results in loss of its repressive function, responsible for prostate cancer progression and invasion.
23178572 these results further demonstrate that HIC1 is a key player in the regulation of the DNA damage response.
22632162 HIV-1 Tat 47-59 peptide downregulates gene expression of hypermethylated in cancer 1 (HIC1) in U-937 macrophages
22552606 Hypermethylation of HIC1 promoter and aberrant expression of HIC1/SIRT1 might contribute to the carcinogenesis of pancreatic cancer.
22544915 A growth-regulatory role of HIC1 in the parathyroid glands and perturbed expression of HIC1 may represent an early event during tumor development.
22510409 these results demonstrate that the activating acetylation to SUMOylation switch of HIC1 is favored by genotoxic stresses to regulate the DNA damage response.
22327210 Identify HIC1 hypermethylation in renal cell carcinoma as an independent predictor of reduced recurrence-free survival.
22315224 identify HIC1 as the first transcription factor in mammals able to recruit PRC2 to some target promoters through its interaction with Polycomb-like proteins.
22194601 early inactivation of HIC1 in breast carcinomas could predispose to stress-induced metastasis through up-regulation of the beta-2 adrenergic receptor
22184117 loss of the regulation of this Eph pathway through HIC1 epigenetic silencing could be an important mechanism in the pathogenesis of epithelial cancers
22136354 Promoter hypermethylation of tumor suppressor HIC1 is associated with prostate carcinoma.
21533545 Silencing of HIC1 and TOB1 expression is a common occurrence in gastric cancer and may contribute to the development and progression of the disease.
21274674 High frequency of methylation at MGMT, RASSFA, and HIC-1 was detected in colorectal carcinoma patients
21104471 This review highlights the role of HIC1 inactivation in solid tumours and particularly in leukaemia development
20682398 Observational study of gene-disease association. (HuGE Navigator)
20682398 Investigated the methylation of the SFRP2, P16, DAPK1, HIC1, and MGMT genes, as well as the mutation of amino acid codons 12 and 13 of the KRAS gene in normal and tumor tissue DNA of patients diagnosed with sporadic colorectal cancer.
20634891 Maternal genes FLNB, HIC1 and ZNF189 were strongly associated with risk of clefting.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20547755 identify MTA1, a subunit of the NuRD complex, as a new HIC1 corepressor
19649206 Our data show the first valid clinical evidence of the deregulation of HIC1-SIRT1-p53 loop in lung tumorigenesis and prognosis
19525223 The tumor suppressor HIC1 is implicated in the transcriptional regulation of the chemokine receptor CXCR7, a key player in the promotion of tumorigenesis in a wide variety of cell types.
19491197 Transcription factors were screened for regulation of a human HIC1 promoter reporter. Found that E2F1 strongly activates the full-length HIC1 promoter reporter.
19486893 ARID1A/BAF250A was identified as a new HIC1 partner.
17982487 Detailed mapping of chromosome 17p deletions reveals HIC1 as a novel tumor suppressor gene candidate telomeric to TP53 in diffuse large B-cell lymphoma
17283066 HIC1 is a target of the class III deacetylase SIRT1 and identify a new posttranslational modification step in the P53-HIC1-SIRT1 regulatory loop.
16762039 HIC1 interaction with the corepressor CtBP depends on a central leucine residue
16724116 These data indicate that the intracellular amounts of HIC1 protein can modulate the level of the transcriptional stimulation of the genes regulated by canonical Wnt/beta-catenin signaling.
16386221 HIC1 is involved in a certain feedback regulation for p53 in tumor suppression through histone deacetylase. (review)
16301995 HIC1 p53-responsive element (HIC1.PRE) is necessary and sufficient to mediate induction of transcription by p53
15488761 In human osteosarcomas, hypermethylation of HIC1 is frequent only in tumors with p53 mutation
15231840 analysis of HIC1 consensus binding sequence and its DNA binding and repressive properties
14688019 Inactivation of HIC1 by hypermethylation is associated with medulloblastoma pathogenesis
14656076 epigenetic silencing of HIC-1 may well contribute to the pathogenesis in the majority of medulloblastomas.
14506157 aberrant methylation of HIC1 may play a role in the pathogenesis of specific pediatric tumors
12052894 The human candidate tumor suppressor gene HIC1 recruits CtBP through a degenerate GLDLSKK motif.
12052894 HIC1 recruits the corepressor CtBP (C-terminal binding protein) through a phylogenetically conserved GLDLSKK motif located in a central region of the protein. This motif is a variant of the "classical" PxDLSxK found in other CtBP-interacting proteins.
11073960 A new major alternative promoter of HIC1 (HIC-1) is conserved in the murine locus and positively regulated by TP53.
10611298 HIC-1 (HIC1) is a transcriptional repressor. However, in contrast to other BTB/POZ transcriptional repressors ( such as BCL6 or PLZF) it fails to recruit SMRT/NCoR-mSin3A/HDAC complexes via its BTB/POZ domain.

AA Sequence

MTFPEADILLKSGECAGQTMLDTMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNALFRAHKNVLAASSA      1 - 70
YLKSLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLADGAEAAAAAAVAPGAEPSLGAVLAAASYLQIPD     71 - 140
LVALCKKRLKRHGKYCHLRGGGGGGGGYAPYGRPGRGLRAATPVIQACYPSPVGPPPPPAAEPPSGPEAA    141 - 210
VNTHCAELYASGPGPAAALCASERRCSPLCGLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYK    211 - 280
EPPLALPSLPPLPFQKLEEAAPPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERG    281 - 350
SPSERCEERGGDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYP    351 - 420
CPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLNAHVEAHVEEEEALYGRAEAAEVAAGAAGLGPPFGGGG    421 - 490
DKVAGAPGGLGELLRPYRCASCDKSYKDPATLRQHEKTHWLTRPYPCTICGKKFTQRGTMTRHMRSHLGL    491 - 560
KPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVCGGKFAQQRNLISHMKMHAVGGAAGAAGALAGLGG    561 - 630
LPGVPGPDGKGKLDFPEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAE    631 - 700
LGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT                                         701 - 733
//

Text Mined References (60)

PMID Year Title
26510908 2015 Epigenetic silencing of HIC1 promotes epithelial-mesenchymal transition and drives progression in esophageal squamous cell carcinoma.
25934696 2015 HIC1 Tumor Suppressor Loss Potentiates TLR2/NF-?B Signaling and Promotes Tissue Damage-Associated Tumorigenesis.
24992983 2014 P53 induction accompanying G2/M arrest upon knockdown of tumor suppressor HIC1 in U87MG glioma cells.
24907396 2014 Physical and functional interaction of the proto-oncogene EVI1 and tumor suppressor gene HIC1 deregulates Bcl-xL mediated block in apoptosis.
24489730 2014 Small activating RNA restores the activity of the tumor suppressor HIC-1 on breast cancer.
24295734 2014 HIC1 silencing in triple-negative breast cancer drives progression through misregulation of LCN2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24076391 2013 The Reelin receptors ApoER2 and VLDLR are direct target genes of HIC1 (Hypermethylated In Cancer 1).
24067369 2013 HIC1 interacts with and modulates the activity of STAT3.
23769968 2013 Inactivation of tumor suppressor gene HIC1 in gastric cancer is reversed via small activating RNAs.
23417673 2013 DNA double-strand breaks lead to activation of hypermethylated in cancer 1 (HIC1) by SUMOylation to regulate DNA repair.
23340301 2013 HIC1 modulates prostate cancer progression by epigenetic modification.
23178572 2013 Identification of p21 (CIP1/WAF1) as a direct target gene of HIC1 (Hypermethylated In Cancer 1).
22552606 2013 Hypermethylation of HIC1 promoter and aberrant expression of HIC1/SIRT1 might contribute to the carcinogenesis of pancreatic cancer.
22544915 2012 Hypermethylated in cancer 1 (HIC1), a tumor suppressor gene epigenetically deregulated in hyperparathyroid tumors by histone H3 lysine modification.
22510409 2012 Molecular dissection of the interaction between HIC1 and SIRT1.
22327210 2012 Prognostic and diagnostic relevance of hypermethylated in cancer 1 (HIC1) CpG island methylation in renal cell carcinoma.
22315224 2012 Hypermethylated in cancer 1 (HIC1) recruits polycomb repressive complex 2 (PRC2) to a subset of its target genes through interaction with human polycomb-like (hPCL) proteins.
22194601 2012 Loss of Hypermethylated in Cancer 1 (HIC1) in breast cancer cells contributes to stress-induced migration and invasion through ?-2 adrenergic receptor (ADRB2) misregulation.
22184117 2012 The receptor tyrosine kinase EphA2 is a direct target gene of hypermethylated in cancer 1 (HIC1).
22136354 2012 Alterations in promoter methylation status of tumor suppressor HIC1, SFRP2, and DAPK1 genes in prostate carcinomas.
21533545 2011 Identification of novel subregions of LOH in gastric cancer and analysis of the HIC1 and TOB1 tumor suppressor genes in these subregions.
21274674 2011 Promoter hypermethylation of RASSF1A, MGMT, and HIC-1 genes in benign and malignant colorectal tumors.
21104471 2010 Inactivation of the hypermethylated in cancer 1 tumour suppressor--not just a question of promoter hypermethylation?
20682398 2010 Gene methylation of SFRP2, P16, DAPK1, HIC1, and MGMT and KRAS mutations in sporadic colorectal cancer.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20547755 2010 Differential regulation of HIC1 target genes by CtBP and NuRD, via an acetylation/SUMOylation switch, in quiescent versus proliferating cells.
20154726 2010 A potential tumor suppressor role for Hic1 in breast cancer through transcriptional repression of ephrin-A1.
19649206 2009 Distinct HIC1-SIRT1-p53 loop deregulation in lung squamous carcinoma and adenocarcinoma patients.
19525223 2009 Scavenger chemokine (CXC motif) receptor 7 (CXCR7) is a direct target gene of HIC1 (hypermethylated in cancer 1).
19491197 2009 The tumor suppressor gene hypermethylated in cancer 1 is transcriptionally regulated by E2F1.
19486893 2009 HIC1 interacts with a specific subunit of SWI/SNF complexes, ARID1A/BAF250A.
18347096 2008 Cooperation between the Hic1 and Ptch1 tumor suppressors in medulloblastoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17982487 2008 Detailed mapping of chromosome 17p deletions reveals HIC1 as a novel tumor suppressor gene candidate telomeric to TP53 in diffuse large B-cell lymphoma.
17283066 2007 An acetylation/deacetylation-SUMOylation switch through a phylogenetically conserved psiKXEP motif in the tumor suppressor HIC1 regulates transcriptional repression activity.
17213307 2007 Metabolic regulation of SIRT1 transcription via a HIC1:CtBP corepressor complex.
17079468 2006 Identification and functional characterization of a novel unspliced transcript variant of HIC-1 in human cancer cells exposed to adverse growth conditions.
16762039 2006 A L225A substitution in the human tumour suppressor HIC1 abolishes its interaction with the corepressor CtBP.
16724116 2006 HIC1 attenuates Wnt signaling by recruitment of TCF-4 and beta-catenin to the nuclear bodies.
16690027 2006 Mechanism of fibroblast growth factor-binding protein 1 repression by TGF-beta.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16386221 2006 [Chromosome arm 17p13.3: could HIC1 be the one ?].
16301995 2006 Identification of the p53 family-responsive element in the promoter region of the tumor suppressor gene hypermethylated in cancer 1.
16269335 2005 Tumor suppressor HIC1 directly regulates SIRT1 to modulate p53-dependent DNA-damage responses.
15488761 2004 Epigenetic and genetic loss of Hic1 function accentuates the role of p53 in tumorigenesis.
15231840 2004 The tumor suppressor gene HIC1 (hypermethylated in cancer 1) is a sequence-specific transcriptional repressor: definition of its consensus binding sequence and analysis of its DNA binding and repressive properties.
15007385 2004 Identification of a second G-C-rich promoter conserved in the human, murine and rat tumor suppressor genes HIC1.
14688019 2004 Identification of tumour-specific epigenetic events in medulloblastoma development by hypermethylation profiling.
14656076 2003 Epigenetic silencing of the HIC-1 gene in human medulloblastomas.
14506157 2003 Aberrant methylation of the HIC1 promoter is a frequent event in specific pediatric neoplasms.
12621583 2003 Refinement of a 400-kb critical region allows genotypic differentiation between isolated lissencephaly, Miller-Dieker syndrome, and other phenotypes secondary to deletions of 17p13.3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12052894 2002 The human candidate tumor suppressor gene HIC1 recruits CtBP through a degenerate GLDLSKK motif.
11554746 2001 Characterization of HRG22, a human homologue of the putative tumor suppressor gene HIC1.
11073960 2001 Identification in the human candidate tumor suppressor gene HIC-1 of a new major alternative TATA-less promoter positively regulated by p53.
10611298 1999 Recruitment of SMRT/N-CoR-mSin3A-HDAC-repressing complexes is not a general mechanism for BTB/POZ transcriptional repressors: the case of HIC-1 and gammaFBP-B.
9838134 1998 The carboxy-terminal end of the candidate tumor suppressor gene HIC-1 is phylogenetically conserved.
9572497 1998 Methylation of the HIC-1 candidate tumor suppressor gene in human breast cancer.
7585125 1995 p53 activates expression of HIC-1, a new candidate tumour suppressor gene on 17p13.3.