Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.52
PubTator Score 12.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Leigh disease 100 4.745 2.4
Disease Target Count Z-score Confidence
Pyruvate decarboxylase deficiency 16 4.965 2.5

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia -1.200 3.6e-02
adrenocortical carcinoma -1.449 3.6e-05
interstitial cystitis -1.100 3.0e-04
intraductal papillary-mucinous neoplasm ... 1.100 8.2e-03
lung cancer 1.200 1.6e-02
lung carcinoma 1.100 6.5e-14
ovarian cancer 1.400 4.7e-05
pancreatic cancer 1.200 1.2e-02
pancreatic carcinoma 1.200 1.2e-02
ulcerative colitis -1.100 2.0e-03

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MGQREMWRLMSRFNAFKRTNTILHHLRMSKHTDAAEEVLLEKKGCTGVITLNRPKFLNALTLNMIRQIYP      1 - 70
QLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQKIAPVFFREEYMLNNAVGSCQKPYVALIH     71 - 140
GITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVYRA    141 - 210
GIATHFVDSEKLAMLEEDLLALKSPSKENIASVLENYHTESKIDRDKSFILEEHMDKINSCFSANTVEEI    211 - 280
IENLQQDGSSFALEQLKVINKMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVL    281 - 350
IDKDQSPKWKPADLKEVTEEDLNNHFKSLGSSDLKF                                      351 - 386
//

Text Mined References (20)

PMID Year Title