Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.10
PubTator Score 10.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 8.0e-12
ependymoma 4679 1.5e-07
ovarian cancer 8520 1.1e-05
pancreatic ductal adenocarcinoma liver metastasis 1962 1.1e-02
osteosarcoma 7950 1.2e-02
Disease Target Count Z-score Confidence
Retinitis pigmentosa 4 38 3.488 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.100 1.5e-07
osteosarcoma 1.518 1.2e-02
ovarian cancer -2.000 1.1e-05
pancreatic ductal adenocarcinoma liver m... -1.790 1.1e-02
psoriasis -1.200 8.0e-12

Protein-protein Interaction (4)

Gene RIF (3)

AA Sequence

MAASLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDV      1 - 70
FPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVS     71 - 140
KELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKI    141 - 210
CNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTT    211 - 280
LMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF                  281 - 336
//

Text Mined References (15)

PMID Year Title