Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.64
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.900 7.1e-05
astrocytoma 1.300 3.8e-02
glioblastoma 1.300 4.6e-03
Multiple Sclerosis 1.500 1.2e-04
Breast cancer 2.300 2.8e-02
group 3 medulloblastoma -1.500 3.1e-03
posterior fossa group A ependymoma 1.100 1.9e-05

AA Sequence

MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAVCTKLANMYSTSTDCREH      1 - 70
CRRGMKAKQLKAEAGRSCQRKGVPIQTPREHSWISCKKEFEANP                               71 - 114
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10444326 1999 Endogenous retroviruses provide the primary polyadenylation signal for two new human genes (HHLA2 and HHLA3).